DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Acsm1

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001101972.2 Gene:Acsm1 / 361638 RGDID:1306813 Length:577 Species:Rattus norvegicus


Alignment Length:413 Identity:101/413 - (24%)
Similarity:168/413 - (40%) Gaps:87/413 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   146 EYEKVKSATKDLQVTIVTMRNHPRGSVRIQDVLTTPVMQNFQPLRLKDGIDHT---------LAI 201
            |.|.|.|....|:..||...::..|.:            ||:.|......|||         :.|
  Rat   171 EVESVASECPGLKTKIVVSDHNHEGWL------------NFRTLLRSASPDHTCVKSKMKDPMVI 223

  Fly   202 LSSSGTSGFPKAVTISNSHKIIVDYMAINNSNIQYTSS-----------TLD--WCSGLSMAITS 253
            ..:|||:|:||              ||.:|..:.:.||           |.|  ||    |:...
  Rat   224 FFTSGTTGYPK--------------MAKHNQGLAFRSSVPSCRKFLKLKTSDVIWC----MSDPG 270

  Fly   254 GVFSTTSIIAD-------------CDFDPGLFCRAIGKYRISMVLLSSS-YLAIFANCPEFESAD 304
            .:.:|...:.:             ..|||.:....:.||.|:..|.:.: |..:...  ...:..
  Rat   271 WILATVGCLLEPWTAGATVFVHNLPQFDPKVIVETLFKYPITQCLAAPAVYRMVLQK--NISNLR 333

  Fly   305 LSSLNYVIFGGSSCSLE--VQRKVRSRLSHDCLNFCYGLTELNSAGSVNLNFDEKPNSVGRAIRG 367
            ..:|.:...||.|...|  .|.|.|:.||   ::..||.:|.....::......|..|:|:||..
  Rat   334 FPTLEHCATGGESLLPEEYEQWKQRTGLS---IHEVYGQSETGITCAIFREMKVKRGSIGKAILP 395

  Fly   368 IKIKVIDEQGEAQEPNVVGEICFHNSQK-----WAGYYKNPDETRQIQDSENWIHTGDLGYVDKD 427
            ..|::|||:|....||..|.|.......     :.||..:|::|.:::..: :.::||...:|:|
  Rat   396 FDIQIIDEKGNILPPNTEGYIGIRIKPTRPLGLFVGYENSPEKTSEVECGD-FYNSGDRATIDED 459

  Fly   428 GYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLVKKP----- 487
            ||::.:.|..|::........|:|:||.:.|.|.|.|:.|....|...|:...|.:|..|     
  Rat   460 GYIWFLGRSDDVINASGYRIGPTEVENALVEHPAVSESAVVSSPDKDRGEVVKAFIVLNPEFLSH 524

  Fly   488 -GTQLEAQDVVEYVRKRITAKFK 509
             ..|| .:::.|:| |.:||.:|
  Rat   525 DQEQL-IKELQEHV-KSVTAPYK 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 101/413 (24%)
AFD_class_I 55..530 CDD:302604 101/413 (24%)
Acsm1NP_001101972.2 AFD_class_I 46..573 CDD:302604 101/413 (24%)
Acs 46..570 CDD:223442 101/413 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.