DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Acsm4

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_859046.1 Gene:Acsm4 / 353317 RGDID:727928 Length:580 Species:Rattus norvegicus


Alignment Length:554 Identity:125/554 - (22%)
Similarity:215/554 - (38%) Gaps:103/554 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 DKLKIWSGREAPSLFSPNLSIGEIIFGDMVNNPKLIAQISITEDIVLTREDLHMNAMRVASYM-R 82
            |.|..||.:|..              |:...||.|.......:::..:.::|...:.:.|:.: :
  Rat    57 DVLDQWSLKEKS--------------GERPANPALWWVNGKGDEVKWSFQELGSLSRKAANVLTK 107

  Fly    83 NMGLGQTDIVGVMGRHTTHQSAVAYAC------FFNGT-------PLHALHNAYEEACIAKLFGI 134
            ..||.:.|.|.|:.........:..||      |..||       .|:.| .|.:..||.....:
  Rat   108 PCGLQRGDRVAVILPRIPEWWLINVACMRTGLVFMPGTIQLTRKDILYRL-QASKAKCIVASEEV 171

  Fly   135 TKPRLIFCDGDEYEKVKSATKDLQVTIVTMRNHPRGSVRIQDVLTTPVMQNFQPLRLKDGIDHTL 199
            . |.:        :.:.|...:|:..::...:...|.:..|::|.:...::   ..::.|....:
  Rat   172 A-PAV--------DSIASECPNLKTKLLVSPHRWDGWLSFQELLQSASEEH---NCVQTGSQEPM 224

  Fly   200 AILSSSGTSGFPKAVTISNSHKIIVDYMAINNSNIQYTSSTLDW---CSGLSMAITSGVFST--- 258
            ||..:|||:|.||....|.| .:.:.|.......:..|||.:.|   .:|...|....||||   
  Rat   225 AIYFTSGTTGSPKMAQHSQS-SLGIGYALCGRYWLDLTSSDIMWNMSDTGWIKAAIGSVFSTWLR 288

  Fly   259 ---TSIIADCDFDPGLFCRAIGKYRISMVLLSSSYLAIFANCPEFESADLSSLNYVIFGGSSCSL 320
               ..:.....|:...|...:..|.|:.:..:.:...:... .:.:......|.:.:.||...:.
  Rat   289 GACVFVHRMAQFNTDTFLDTLTSYPITTLCSAPTVYRMLVQ-QDLKRYQFKRLRHCLTGGEPLNP 352

  Fly   321 EV--QRKVRSRLSHDCLNFCYGLTELNSAGSVNLNFDEKPNSVGRAIRGIKIKVIDEQGEAQEPN 383
            ||  |.|.::.|.   |...||.||:....:.....:.||.|:|:.:....:::|||.|......
  Rat   353 EVLEQWKAQTGLE---LYEGYGQTEVGIICANRKGEEIKPGSMGKGVVPYDVQIIDEHGNILPSG 414

  Fly   384 VVGEI----------CFHNSQKWAGYYKNPDETRQIQDS---ENWIHTGDLGYVDKDGYLFVIDR 435
            ..|||          ||     ::.|..||::|    |:   .|:..|||.|.:|.||||:.:.|
  Rat   415 KEGEIALRLGSDRPFCF-----FSEYVDNPEKT----DATIRRNFYITGDRGVMDDDGYLWFVGR 470

  Fly   436 LKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLV--------KKPGTQLE 492
            ..|::........|.|:|:.:.|.|.|:|:.|....||:.|:...|.:|        .:.....|
  Rat   471 ADDVIISSGYRIGPFEVESALIEHPAVVESAVVSSPDPIRGEVVKAFIVLAAPFKSSNREKLTAE 535

  Fly   493 AQD-------------VVEYVR---KRITAKFKQ 510
            .||             .||:|:   |.||.|.|:
  Rat   536 LQDHVKNSTAPYKYPRKVEFVQELPKTITGKIKR 569

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 120/538 (22%)
AFD_class_I 55..530 CDD:302604 116/518 (22%)
Acsm4NP_859046.1 MACS_euk 48..577 CDD:341251 125/554 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.