DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Slc27a4

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001094176.1 Gene:Slc27a4 / 311839 RGDID:1307383 Length:643 Species:Rattus norvegicus


Alignment Length:471 Identity:89/471 - (18%)
Similarity:171/471 - (36%) Gaps:69/471 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 VASYMRN--------MGLGQTDIVGVMGRHTTHQSAVAYACFFNGTPLHALHNAYEEACIAKLFG 133
            ||.:|.|        :|:.:..:...:......:.|:.: |.........:..:...:.:.::..
  Rat   129 VALFMENRNEFVGLWLGMAKLGVEAALINTNLRRDALRH-CLDTSKARALIFGSEMASAVYEIQA 192

  Fly   134 ITKPRL-IFCDGD-EYEKVKSATKDLQVTIVTMRNHPRGSVRIQDVLTTPVMQNFQPLRLKDGID 196
            |..|.| :||.|. |...|.:.|:.|.   ..:.:.|:....|.|                .|..
  Rat   193 ILDPTLTLFCSGSWEPSTVPANTEHLD---PLLEDAPKHLPSIPD----------------KGFT 238

  Fly   197 HTLAILSSSGTSGFPKAVTISNSH----KIIVDY-MAINNSNIQYTSSTLDWCSGLSMAITSGVF 256
            ..|..:.:|||:|.|||..:.:|.    ..:|.| ..:...:|.|....|...:|..:.|...|.
  Rat   239 DKLFYIYTSGTTGLPKAAIVVHSRYYRMAALVYYGFRMRPDDIVYDCLPLYHSAGNIVGIGQCVL 303

  Fly   257 STTSIIADCDFDPGLFCRAIGKYRISMVLLSSSYLAIFANCPEFESADLSSLNYVIFGGSSCSLE 321
            ...:::....|....|.....||..::|...........|.|..|:.....:...:  |:.....
  Rat   304 HGMTVVIRKKFSASRFWDDCIKYNCTIVQYIGELCRYLLNQPPREAESRHKVRMAL--GNGLRQS 366

  Fly   322 VQRKVRSRLSHDCLNFCYGLTELN-SAGSVNLNFDEKPNSVGRAIRGIK-------IKVIDEQGE 378
            :.....||.....:...||.||.| |.|    |||.:..:.|...|.:.       ::|.::..|
  Rat   367 IWTDFSSRFHIPQVAEFYGATECNCSLG----NFDSQVGACGFNSRILSFVYPIRLVRVNEDTME 427

  Fly   379 --------------AQEPNVVGEICFHNS-QKWAGYYKNPDETRQI-----QDSENWIHTGDLGY 423
                          .|...:||.|...:. :::.||.......::|     :..:....|||:..
  Rat   428 LIRGPDGVCIPCQPGQPGQLVGRIIQQDPLRRFDGYLNQGANNKKIASDVFKKGDQAYLTGDVLV 492

  Fly   424 VDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLVKKPG 488
            :|:.|||:..||..|..:::......:|:|..::.:..:.:..|:|:..|.....|..:.|..|.
  Rat   493 MDELGYLYFRDRTGDTFRWKGENVSTTEVEGTLSRLLQMADVAVYGVEVPGAEGRAGMAAVASPT 557

  Fly   489 TQLEAQDVVEYVRKRI 504
            :..:.:...:.::|.:
  Rat   558 SNCDLESFAQTLKKEL 573

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 89/471 (19%)
AFD_class_I 55..530 CDD:302604 89/471 (19%)
Slc27a4NP_001094176.1 PRK08279 75..643 CDD:236217 89/471 (19%)
hsFATP4_like 99..608 CDD:213305 89/471 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343027
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.