DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Slc27a3

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001099909.1 Gene:Slc27a3 / 295219 RGDID:1310605 Length:667 Species:Rattus norvegicus


Alignment Length:429 Identity:88/429 - (20%)
Similarity:160/429 - (37%) Gaps:95/429 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   174 IQDVLTTPVMQNFQP----LRLKDGIDHTLAILSSSGTSGFPKAVTISNSHKII-----VDYMAI 229
            |.::|:....|..:|    |.....|..|...:.:|||:|.|||..:|:. |::     .....:
  Rat   238 ISNLLSEAATQVDEPVPGYLSAPQNIMDTCLYIFTSGTTGLPKAARVSHL-KVLQCQGFYQLCGV 301

  Fly   230 NNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIADCDFDPGLFCRAIGKYRISMVLLSSSYLAIF 294
            :..::.|.:..|...||..:.|...:....:::....|....|.....::.:::...........
  Rat   302 HQEDVIYLALPLYHMSGSLLGIVGCLGIGATVVLKPKFSASQFWEDCQRHGVTVFQYIGELCRYL 366

  Fly   295 ANCPEFESADLSSLNYVIFGGSSCSLEVQRKVRSRLSHDC------------LNFCYGLTELNSA 347
            .|.|..:              :.|..:|:..|.|.|..|.            :...||.||.|.|
  Rat   367 VNQPPSK--------------AECGHKVRLAVGSGLRPDTWDRFVRRFGPLQILETYGATEGNVA 417

  Fly   348 GSVNLNFDEKPNSVGRA-----------------IRGIKIKVIDEQGE--AQEPNVVGEICFHNS 393
               ..|:..:..:||||                 :.|..|:  :.||.  |..|...|.:....|
  Rat   418 ---TFNYTGQQGAVGRASWLYKHIFPFSLIRYDVMTGEPIR--NAQGHCMAASPGEPGLLVAPVS 477

  Fly   394 QK--WAGYYKNPD--ETRQIQD----SENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPS 450
            |:  :.||...|:  :.:.::|    .:.:.:||||...|:.|:|...||..|..:::......:
  Rat   478 QESPFLGYAGAPELAQEKLLKDVFRPGDIFFNTGDLLVCDEQGFLHFHDRTGDTFRWKGENVATT 542

  Fly   451 EIENVIAEMPNVLEACVFGIWDPVN-GDEAAASLVKKPGTQLE--------AQDVVEYVRKRI-- 504
            |:..|:..:..:.|..::|:..|.: |....|:|..:|...|:        ::::..|.|.|.  
  Rat   543 EVAEVLEALDFLQEVNIYGVTVPGHEGRAGMAALALRPPQALDLVQLYTHVSENLPPYARPRFLR 607

  Fly   505 -------TAKFKQLNGGALIVDQIVRSGNRKTNRSAVKE 536
                   |..|||         |.||..|...:.||:.:
  Rat   608 LQESLATTETFKQ---------QKVRMANEGFDPSALSD 637

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 88/429 (21%)
AFD_class_I 55..530 CDD:302604 86/421 (20%)
Slc27a3NP_001099909.1 PRK08279 60..666 CDD:236217 88/429 (21%)
AFD_class_I 91..657 CDD:302604 88/429 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342912
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.