DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and Slc27a5

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_033538.2 Gene:Slc27a5 / 26459 MGIID:1347100 Length:689 Species:Mus musculus


Alignment Length:374 Identity:82/374 - (21%)
Similarity:148/374 - (39%) Gaps:68/374 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SSGTSGFPKAVTISNSHKI----IVDYMAINNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIAD 264
            :|||:|.||...:|:...|    ::.:......::.|....|....||.:    |......:.|.
Mouse   294 TSGTTGLPKPAILSHERVIQVSNVLSFCGCRADDVVYDVLPLYHTIGLVL----GFLGCLQVGAT 354

  Fly   265 C----DFDPGLFCRAIGKYRISMVLLSSSYLAIFANCPEFESADLSSLNYVIFGGSSCSLEVQRK 325
            |    .|....|.....::.::::|.....|....|.||.....:.::...:  |:.....|.:.
Mouse   355 CVLAPKFSASRFWAECRQHGVTVILYVGEILRYLCNVPEQPEDKIHTVRLAM--GNGLRANVWKN 417

  Fly   326 VRSRLSHDCLNFCYGLTELNSAGSVNL-NFDEKPNSVGRAIRGIKI---------------KVID 374
            .:.|.....:...||.||    |:|.| |:.....:|||....:::               .:.|
Mouse   418 FQQRFGPIRIWEFYGSTE----GNVGLMNYVGHCGAVGRTSCILRMLTPFELVQFDIETAEPLRD 478

  Fly   375 EQGEA--QEPNVVGEIC--FHNSQKWAGYYKNPDET--------RQIQDSENWIHTGDLGYVDKD 427
            :||..  .||...|.:.  ...:|.:.||..:..|:        |::.|.  :.:|||:..:|::
Mouse   479 KQGFCIPVEPGKPGLLLTKVRKNQPFLGYRGSQAESNRKLVANVRRVGDL--YFNTGDVLTLDQE 541

  Fly   428 GYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDE-----AAASLVKKP 487
            |:.:..|||.|..:::.......|:|.|::.:..:.|..|:|:  ||.|.|     ||..|.  |
Mouse   542 GFFYFQDRLGDTFRWKGENVSTGEVECVLSSLDFLEEVNVYGV--PVPGCEGKVGMAAVKLA--P 602

  Fly   488 GTQLEAQDVVEYVRK-----------RITAKFKQLNGGALIVDQIVRSG 525
            |...:.|.:.::||.           ||....:..|...|:..::||.|
Mouse   603 GKTFDGQKLYQHVRSWLPAYATPHFIRIQDSLEITNTYKLVKSRLVREG 651

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 82/374 (22%)
AFD_class_I 55..530 CDD:302604 82/374 (22%)
Slc27a5NP_033538.2 PRK08279 100..685 CDD:236217 82/374 (22%)
AFD_class_I 139..679 CDD:302604 82/374 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167839237
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.