DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and acs-6

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_495450.1 Gene:acs-6 / 174156 WormBaseID:WBGene00022849 Length:565 Species:Caenorhabditis elegans


Alignment Length:438 Identity:108/438 - (24%)
Similarity:192/438 - (43%) Gaps:61/438 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   139 LIFCDGDEYEKVKSATKDLQVT--IVTMRNHPRGSVRIQDVL------TTPVMQNFQPLRLKDGI 195
            ::|.|.|...:::.||......  |:.:|..|..:...::||      .||    .||:.:...:
 Worm   122 IVFTDEDRLARIRRATAKCPGVRKIICLRTFPLRTEFPENVLDYVELTQTP----DQPINVNVSM 182

  Fly   196 DHTLAILSSSGTSGFPKAVTISNSHKIIVDYMAINNSNI------------------QYTSSTLD 242
            |....:..||||:|.||...:  :|:.|...:.:..:::                  ::|...|.
 Worm   183 DSIALLPYSSGTTGRPKGCQL--THRNIGAMLDVAKAHLETDVAPAMFGKEKATWHKEHTVLLLP 245

  Fly   243 W--CSGLSMAITSGVFSTTSIIADCDFDPGLFCRAIGKYRISMVLLSSSYLAIFAN---CPEFES 302
            |  ..||:....:.:...|.|:.. .||..:....|..|::.:..|....|...|.   .|.|.:
 Worm   246 WYHAYGLNTMFETILLGMTGIVFK-KFDTIVMLNRIKFYKVKLAWLVPPMLIFLAKDPMVPIFNT 309

  Fly   303 ADLSSLNYVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVNLNFDEKP--------N 359
            |..  |..::..|::...::..:|..|..:..|...||:||:       :.|...|        .
 Worm   310 APF--LKVIMSAGATAGKQLCEEVSKRFPNAWLCQAYGMTEM-------VQFTTIPRFEDGNCFE 365

  Fly   360 SVGRAIRGIKIKVID-EQGEAQEPNVVGEICFHNSQKWAGYYKNPDETRQIQDSENWIHTGDLGY 423
            :||......::|::| |:.|....|.||::||.......||.|.  |...|.|.:.::.|||||.
 Worm   366 TVGNLASTYELKILDKEKKEITTINTVGQLCFRGPTVMKGYLKR--EEADIIDKDGFLLTGDLGS 428

  Fly   424 VDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLVKKPG 488
            :|..|.:.|..|:|:::|...:...|.|||:|:...|.|.:..|.|:.|...|:...|.:|||..
 Worm   429 IDDKGRIHVTGRIKELIKVNGMQVPPVEIEDVLLLHPKVKDCAVIGVPDEHKGESPKAYIVKKDH 493

  Fly   489 TQLEAQDVVEYVRKRITAKFKQLNGGALIVDQIVRSGNRKTNRSAVKE 536
            |..|| ::.|:||::::: :|.::....| |.|.:..:.|..|..:|:
 Worm   494 TLTEA-ELTEFVRQKLSS-YKWIDTYEFI-DSIPKLPSGKIQRKKLKK 538

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 108/438 (25%)
AFD_class_I 55..530 CDD:302604 106/430 (25%)
acs-6NP_495450.1 CaiC 15..541 CDD:223395 108/438 (25%)
Firefly_Luc_like 37..532 CDD:213279 106/430 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160160504
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24096
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.