DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and acsm3

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_002932029.3 Gene:acsm3 / 100491087 XenbaseID:XB-GENE-486978 Length:581 Species:Xenopus tropicalis


Alignment Length:369 Identity:91/369 - (24%)
Similarity:158/369 - (42%) Gaps:51/369 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   199 LAILSSSGTSGFPKAVTISNSH-------KIIVDY-MAINNSNIQYTSSTLDWCSGLSMAITSGV 255
            :.|..:|||:|.||..  .:||       |:...| |.:..::|.:..|...|    :.:..|.|
 Frog   225 MTIFFTSGTTGSPKMT--EHSHCSYGLGLKVNGKYWMDLTPTDIVWNMSDTGW----AKSAWSSV 283

  Fly   256 FSTTSIIADCDFDPGLFCRAIGKYRISMVL--LSSSYLAIFANCP---------EFESADLSSLN 309
            |:.. |...|     :|..::.::..::||  ||:..:..|.:.|         .|.|....||.
 Frog   284 FAPW-IQGSC-----VFAHSMPRFDTNIVLKTLSTFPITTFCSAPTAYRMLVLQNFASYKFKSLQ 342

  Fly   310 YVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVNLNFDEKPNSVGRAIRGIKIKVID 374
            :.:..|...:.:|..:.:.:...|... .||.||.............||.|:|:......::::|
 Frog   343 HCVSAGEPINPQVMEQWKEQTGLDIYE-GYGQTETVLICGTFKGMKIKPGSMGKPSPAYDVEIVD 406

  Fly   375 EQGEAQEPNVVGEICFH-NSQK----WAGYYKNPDETRQIQDSENWIHTGDLGYVDKDGYLFVID 434
            |.|........|:|... ..||    ::.|..:|:.|...:.. |:..|||.|..|:|||.:.:.
 Frog   407 ENGNVLPQGKEGDIAIRILPQKPFCLFSQYTGDPERTASTRRG-NFYLTGDRGIKDEDGYFWFVG 470

  Fly   435 RLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAAASLVKKP---GTQLE--AQ 494
            |..|::........|.|:|:.:.|.|.|.|:.|....||:.|:...|.:|..|   |...|  |.
 Frog   471 RSDDVILSSGYRIGPFEVESALIEHPAVAESAVVSSPDPIRGEVVKAFVVLAPAYNGYDPEKLAL 535

  Fly   495 DVVEYVRKRITAKFK---QLNGGALIVDQIVRSGNRKTNRSAVK 535
            ::.|:|| .|||.:|   ::.    .|.|:.::.:.|..|:.::
 Frog   536 ELQEHVR-NITAPYKYPRKIE----FVQQLPKTVSGKIRRNELR 574

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 91/369 (25%)
AFD_class_I 55..530 CDD:302604 90/362 (25%)
acsm3XP_002932029.3 MACS_euk 49..578 CDD:341251 91/369 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.