DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and acsbg1

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:220 Identity:33/220 - (15%)
Similarity:67/220 - (30%) Gaps:92/220 - (41%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LTREDLHMNAMRVASYMRNMGLGQTDIVGVMGRHTTHQSAVAYACFFNGTP--LHALHNAYEEAC 127
            :|..|.:....:.|.....:||.:...||::|              ||...  :.|:...:....
 Frog    74 VTFMDYYKLCRQAAKSFLKLGLERFHSVGILG--------------FNSEEWFISAIGTVFAGGI 124

  Fly   128 IAKLFGITKPRLIFCDGDEYEKVKSATKDLQVTIVTMRNHPRGSVRIQDVLTTPVMQNFQPLRLK 192
            |..::....|          |.......|.::.|:.:.|..    :::.:           |::.
 Frog   125 ITGIYTTNSP----------EACHYVASDCKMNIIVVENQK----QLEKI-----------LQIW 164

  Fly   193 DGIDHTLAILS-----------------------------------------------SSGTSGF 210
            ||:.|..|::.                                               :|||:|.
 Frog   165 DGLPHLKAVVQYKGNLQEKRPNLYTWEEFMEFGKDIADAHLDDIINSQKANQCCVLIYTSGTTGN 229

  Fly   211 PKAVTISNSH----KIIVDYMAINN 231
            ||.|.:|:.:    ||:.::..|.:
 Frog   230 PKGVMLSHDNVWGIKILPEWPRITS 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 33/220 (15%)
AFD_class_I 55..530 CDD:302604 33/220 (15%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 30/204 (15%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.