DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and acsm3

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001104706.1 Gene:acsm3 / 100002035 ZFINID:ZDB-GENE-080220-22 Length:591 Species:Danio rerio


Alignment Length:413 Identity:92/413 - (22%)
Similarity:169/413 - (40%) Gaps:77/413 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   178 LTTPVMQNFQPL-----------RLKDGIDHT---------LAILSSSGTSGFPK---------- 212
            ::|.::.:.:|:           |:.|  ||.         :.|..:|||:|.||          
Zfish   194 ISTKLLLSHKPMDGWGNLTELMGRVSD--DHVCVDTSSEEPMTIFFTSGTTGSPKMTQHSHCSYG 256

  Fly   213 -AVTISNSHKIIVDYMAINNSNIQYTSSTLDWCSGLSMAITSGVFSTTSIIADCDFDPGLFCRAI 276
             .:|::..:     ::.:...::.:.:|...|    :.:..|.||:.. |...|     :|...:
Zfish   257 LGLTVNGRY-----WLDLTEQDVFWNTSDTGW----AKSAWSSVFAPW-IQGAC-----VFVHHM 306

  Fly   277 GKYRISMVLLSSSYLAI--FANCPE----FESADLS-----SLNYVIFGGSSCSLEVQRKVRSRL 330
            .::..:.||.:.|:..|  |...|.    ....|||     :|.:.:..|...:.||..|.:...
Zfish   307 PRFDTNTVLKTLSHYPITTFCTAPTAYRMLVQDDLSKYKFQALEHCLCAGEPINPEVMCKWKELT 371

  Fly   331 SHDCLNFCYGLTELNSAGSVNLNFDEKPNSVGRAIRGIKIKVIDEQGEAQEPNVVGEICFHNSQK 395
            ..|... .||.||.............||.|.|:|..|..::|:||.|........|::......:
Zfish   372 GLDIYE-GYGQTETVLIAGTFKGMKIKPGSFGKASPGYDVQVVDENGSVVPKGQEGDLGIRVKPE 435

  Fly   396 -----WAGYYKNPDETRQIQDSENWIHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENV 455
                 :..|...|..|.:....:.:: |||.|.:|.:|||:.|.|..|::........|.|:||.
Zfish   436 RPFSLFTEYTGEPVRTAECFRGDFYL-TGDRGMMDDEGYLWFIGRSDDVILSAGYRIGPFEVENA 499

  Fly   456 IAEMPNVLEACVFGIWDPVNGDEAAASLVKKPGTQLEA-QDVVEYVR---KRITAKFK---QLNG 513
            :.|.|.|.|:.|....|||.|:...|.:|.....:..| :::::.::   |.|||.:|   ::. 
Zfish   500 LIEHPAVAESAVVSSPDPVRGEVVKAFVVLTADFKSRAHKELIKELQTHVKSITAPYKYPRKIE- 563

  Fly   514 GALIVDQIVRSGNRKTNRSAVKE 536
               .|||:.::.:.|..|..:::
Zfish   564 ---FVDQLPKTVSGKIRRVELRK 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 92/413 (22%)
AFD_class_I 55..530 CDD:302604 91/405 (22%)
acsm3NP_001104706.1 Acs 54..583 CDD:223442 92/411 (22%)
AFD_class_I 57..586 CDD:302604 92/413 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.