DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and Slc27a1

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_006253015.1 Gene:Slc27a1 / 94172 RGDID:620927 Length:649 Species:Rattus norvegicus


Alignment Length:579 Identity:129/579 - (22%)
Similarity:210/579 - (36%) Gaps:189/579 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 IFQ-----QMERNAMLTAQISVTENTELTWKDIQTNAMKVASYMRKLGLEQGDFVGVI--GR--- 97
            |||     |.||.|::.|...:.    .|:..:.|.:..||:...:||...||.|.|.  ||   
  Rat    84 IFQAVAQRQPERLALVDASSGIC----WTFAQLDTYSNAVANLFLQLGFAPGDVVAVFLEGRPEF 144

  Fly    98 ----------------LTTHL----------TALAYACFFNGTPYHALHTEYEQSAIERLFGITK 136
                            |..:|          |:.|.|..:.|....|:....||        :.|
  Rat   145 VGLWLGLAKAGVVAALLNVNLRREPLAFCLGTSAAKALIYGGEMAAAVAEVSEQ--------LGK 201

  Fly   137 PRLIFCDGD-EFEKVQAATKGLQVQIVTMRNHPAGILRIQDILTTPVEMNFRPVRLKDGTDQLLA 200
            ..|.||.|| ..|.|...|:.|...:.             :..|||:..  .|.:   |.|..|.
  Rat   202 SLLKFCSGDLGPESVLPDTQLLDPMLA-------------EAPTTPLAQ--APGK---GMDDRLF 248

  Fly   201 ILSSSGTSGLPK-AVTISNSHQIIGSF----LPVDSSIIQYNPNTLDWASGITMTINAAV----- 255
            .:.:|||:|||| |:.:.:.:..|.:|    ..:.::.:.|:...|..::|..|.:...:     
  Rat   249 YIYTSGTTGLPKAAIVVHSRYYRIAAFGHHSYSMRANDVLYDCLPLYHSAGNIMGVGQCIIYGLT 313

  Fly   256 ------FSLTSIIEDCDFDPANLCGLIEKYRISMVFVSSSQLAMLSNCPEFYAADLSSVKYFFYG 314
                  ||.:...:||           .||                ||        :.|:|.   
  Rat   314 VVLRKKFSASRFWDDC-----------VKY----------------NC--------TVVQYI--- 340

  Fly   315 GSNC-----------------SLEVQNKIRSRLSNEC--------VNFSYTLTELNSPGCLNFNF 354
            |..|                 .|.|.|.:|..:..|.        :...|..||.|   |...|.
  Rat   341 GEICRYLLRQPVRDVERRHHVRLAVGNGLRPAIWEEFTQRFGVRQIGEFYGATECN---CSIANM 402

  Fly   355 DEKPNSVG---------RPVRGIQIKIVNE-----LGEAQG---------PN-VVGEICFNNGQ- 394
            |.|..|.|         .|:|.::   |||     |.::||         |. :||:|   |.| 
  Rat   403 DGKVGSCGFNSRILTHVYPIRLVK---VNEDTMEPLRDSQGLCIPCQPGEPGLLVGQI---NQQD 461

  Fly   395 ---KWPGYYKNPEETKKMQDS-----ENWFHTGDLGYMDEDGYLFIIDRLKDMLKYQTIMYYPSE 451
               ::.||..:....||:..|     ::.:.:||:..|||.||::..||..|..:::......:|
  Rat   462 PLRRFDGYVSDSATNKKIAHSVFRKGDSAYLSGDVLVMDELGYMYFRDRSGDTFRWRGENVSTTE 526

  Fly   452 IESVIAEMPNVVEACVFGIWDPVYGDKAAASVVKKQGTQLEAQDVVEYVRKRIPAKFKQ 510
            :|:|::.:....:..|:|:..|....||..:.:.....||:...:.:.::| :.|.:.|
  Rat   527 VEAVLSRLLGQTDVAVYGVAVPGVEGKAGMAAIADPHNQLDPNSMYQELQK-VLASYAQ 584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 129/579 (22%)
Firefly_Luc_like 55..530 CDD:213279 122/562 (22%)
Slc27a1XP_006253015.1 PRK08279 45..649 CDD:236217 129/579 (22%)
AFD_class_I 107..614 CDD:302604 121/552 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.