DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and AAE12

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_176764.1 Gene:AAE12 / 842901 AraportID:AT1G65890 Length:578 Species:Arabidopsis thaliana


Alignment Length:542 Identity:114/542 - (21%)
Similarity:212/542 - (39%) Gaps:113/542 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 TELTWKDIQTNAMKVASYMRKLGLEQGDFVGVIGRLTTHLTALAYACFFNGTPYHALHTEYEQSA 127
            |..||........::|:.:..|.:.:.|.|.|:...|..:..:.:|....|...:.::|..:.::
plant    38 TRFTWPQTYDRCCRLAASLISLNIGKNDVVSVVAPNTPAMYEMHFAVPMAGAVLNPINTRLDATS 102

  Fly   128 IERLFGITKPRLIFC------------------DGD-----------EFEKVQAATKGLQVQIVT 163
            |..:....||:::|.                  |.:           :|.| :.:::....:.:.
plant   103 IAAILRHAKPKILFIYRSFEPLAREILQLLSSEDSNLNLPVIFIHEIDFPK-RVSSEESDYECLI 166

  Fly   164 MRNHPAGILR-----IQDILTTPVEMNFRPVRLKDGTDQLLAILSSSGTSGLPKAVTISNSHQII 223
            .|..|..:|.     ||| ...|:.:|:                 :|||:..||.|.||:.    
plant   167 QRGEPTPLLLARMFCIQD-EHDPISLNY-----------------TSGTTADPKGVVISHR---- 209

  Fly   224 GSFLPVDSSIIQYNPNTLD---W------ASGITMTINAAVFSLTSIIEDC--DFDPANLCGLIE 277
            |::|...|:||.:...|..   |      .:|.|.|...|....||:   |  ......:...||
plant   210 GAYLSTLSAIIGWEMGTCPVYLWTLPMFHCNGWTFTWGTAARGGTSV---CMRHVTAPEIYKNIE 271

  Fly   278 KYRISMVFVSSSQLAMLSNCPEFYAADLSSVKYFFYGGSNCSLEVQNKIRSRLSNECVNFSYTLT 342
            .:.::.:....:...:|........:..|...:...|||.....:..|:: ||..: |..:|.||
plant   272 MHNVTHMCCVPTVFNILLKGNSLDLSHRSGPVHVLTGGSPPPAALVKKVQ-RLGFQ-VMHAYGLT 334

  Fly   343 ELNSPGCLNFNFDEKPNSV------------GRPVRGI-QIKIVNELGEAQGP---NVVGEICFN 391
            |...| .|...:.::.|.:            |..:.|: ::.:.|:..:...|   ..:|||...
plant   335 EATGP-VLFCEWQDEWNRLPENQQMELKARQGLSILGLTEVDVRNKETQESVPRDGKTMGEIVMK 398

  Fly   392 NGQKWPGYYKNPEETKKMQDSENWFHTGDLGYMDEDGYLFIIDRLKDMLKYQTIMYYPSEIESVI 456
            ......||.|||:.|.: .....|.::||:|.:..||::.|.||.||::..........|:|::|
plant   399 GSSIMKGYLKNPKATYE-AFKHGWLNSGDVGVIHPDGHVEIKDRSKDIIISGGENISSVEVENII 462

  Fly   457 AEMPNVVEACVFGIWDPVYGDKAAASVVKKQGTQ----------LEAQDVVEYVRKRI-----PA 506
            .:.|.|:|..|..:..|.:|:...|.||.::|..          .:.:|::||.|:.:     |.
plant   463 YKYPKVLETAVVAMPHPTWGETPCAFVVLEKGETNNEDREDKLVTKERDLIEYCRENLPHFMCPR 527

  Fly   507 KFKQLNGGALIVDHIIQSGNRK 528
            |       .:.:|.:.::||.|
plant   528 K-------VVFLDELPKNGNGK 542

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 114/542 (21%)
Firefly_Luc_like 55..530 CDD:213279 114/542 (21%)
AAE12NP_176764.1 PLN03102 1..578 CDD:215576 114/542 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.