DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and Slc27a5

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_077057.1 Gene:Slc27a5 / 79111 RGDID:708535 Length:690 Species:Rattus norvegicus


Alignment Length:344 Identity:76/344 - (22%)
Similarity:140/344 - (40%) Gaps:57/344 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SSGTSGLPKAVTISNSHQI----IGSFLPVDSSIIQYNPNTLDWASGITM-----------TINA 253
            :|||:||||...:|:...|    :.||....:..:.||...|..:.|:.:           .:.|
  Rat   295 TSGTTGLPKPAILSHERVIQMSNVLSFCGRTADDVVYNVLPLYHSMGLVLGVLGCLQLGATCVLA 359

  Fly   254 AVFSLTSIIEDCDFDPANLCGLIEKYRISMVFVSSSQLAMLSNCPEFYAADLSSVKYFFYGGSNC 318
            ..||.:....:|           .:|.:::|......|..|.|.|........:|::..  |:..
  Rat   360 PKFSASRYWAEC-----------RQYSVTVVLYVGEVLRYLCNVPGQPEDKKHTVRFAL--GNGL 411

  Fly   319 SLEVQNKIRSRLSNECVNFSYTLTELNSPGCLNFNFDEKPNSVGR---------PVRGIQ--IKI 372
            ..:|....:.|.....:...|..||.| .|.:  |:.....:||:         |:..:|  |:.
  Rat   412 RADVWENFQQRFGPIQIWELYGSTEGN-VGLM--NYVGHCGAVGKTSCFIRMLTPLELVQFDIET 473

  Fly   373 VNELGEAQG---PNVVGE-----ICFNNGQKWPGYYKNPEETKK------MQDSENWFHTGDLGY 423
            ...:.:.||   |...|:     ......|.:.||..:.:|||:      .|..:.:::|||:..
  Rat   474 AEPVRDKQGFCIPVETGKPGLLLTKIRKNQPFLGYRGSQDETKRKLVANVRQVGDLYYNTGDVLA 538

  Fly   424 MDEDGYLFIIDRLKDMLKYQTIMYYPSEIESVIAEMPNVVEACVFGIWDPVYGDKAAASVVK-KQ 487
            :|::|:.:..|||.|..:::.......|:|.|::.:..:.|..|:|:..|....|...:.|| ..
  Rat   539 LDQEGFFYFRDRLGDTFRWKGENVSTREVEGVLSILDFLEEVNVYGVTVPGCEGKVGMAAVKLAP 603

  Fly   488 GTQLEAQDVVEYVRKRIPA 506
            |...:.|.:.::||..:||
  Rat   604 GKTFDGQKLYQHVRSWLPA 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 76/344 (22%)
Firefly_Luc_like 55..530 CDD:213279 76/344 (22%)
Slc27a5NP_077057.1 PRK08279 101..690 CDD:236217 76/344 (22%)
AFD_class_I 140..680 CDD:302604 76/344 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166343038
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.