DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and Slc27a2

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_113924.2 Gene:Slc27a2 / 65192 RGDID:71103 Length:620 Species:Rattus norvegicus


Alignment Length:510 Identity:108/510 - (21%)
Similarity:203/510 - (39%) Gaps:104/510 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LTWKDIQTNAMKVASYMR-KLGLEQGDFVGV-IGRLTTH----LTALAYACFFNGTPYHALHTEY 123
            ||:..:...:.:||..:. .|||.|||.|.: :|....:    |..|...|     |...|:...
  Rat    79 LTYAQVDRRSNQVARALHDHLGLRQGDCVALFMGNEPAYVWLWLGLLKLGC-----PMACLNYNI 138

  Fly   124 EQSAIERLFGITKPRLIFCDGDEFEKVQAA-----TKGLQVQIVTMRNHPAGILRIQD----ILT 179
            ...::...|.....:::....:..|.|:..     .:|:.|..|:..::..|:..:.|    :..
  Rat   139 RAKSLLHCFQCCGAKVLLASPELHEAVEEVLPTLKKEGMSVFYVSRTSNTNGVDTVLDKVDGVSA 203

  Fly   180 TPVEMNFRPVRLKDGTDQLLAI-LSSSGTSGLPKAVTISNSHQIIGSFLPVDSSI----IQYNPN 239
            .|:..::|    .:.|....|: :.:|||:|||||.||::.....|:.|.:.|.|    :.|...
  Rat   204 DPIPESWR----SEVTFTTPAVYIYTSGTTGLPKAATINHHRLWYGTSLALRSGIKAHDVIYTTM 264

  Fly   240 TLDWASGITMTINAAV-----------FSLTSIIEDCDFDPANLCGLIEKYRISMVFVSSSQLAM 293
            .|..::.:.:.::..:           ||.:...:||           .||..:::......|..
  Rat   265 PLYHSAALMIGLHGCIVVGATFALRSKFSASQFWDDC-----------RKYNATVIQYIGELLRY 318

  Fly   294 LSNCPEFYAADLSSVKYFFYGGSNCSLEVQNKIRSRLSNECVNFSYTLTELNSPGCLNF-NFDEK 357
            |.|.|:........||...  |:....:|..:...|..:..:...|..||    |.:.| |:..|
  Rat   319 LCNTPQKPNDRDHKVKIAL--GNGLRGDVWREFIKRFGDIHIYEFYASTE----GNIGFMNYPRK 377

  Fly   358 PNSVGR----------------------PVR---GIQIKIVNELGEAQGPNVVGEICFNNGQKWP 397
            ..:|||                      |||   |..||:..  ||      ||.:.....:..|
  Rat   378 IGAVGRENYLQKKVVRHELIKYDVEKDEPVRDANGYCIKVPK--GE------VGLLICKITELTP 434

  Fly   398 --GYY--KNPEETKKMQD----SENWFHTGDLGYMDEDGYLFIIDRLKDMLKYQTIMYYPSEIES 454
              ||.  |...|.||::|    .:.:|::|||..:|.:.:::..||:.|..:::......:|:..
  Rat   435 FFGYAGGKTQTEKKKLRDVFKKGDVYFNSGDLLMIDRENFIYFHDRVGDTFRWKGENVATTEVAD 499

  Fly   455 VIAEMPNVVEACVFGIWDPVYGDK---AAASVVKKQGTQLEAQDVVEYVRKRIPA 506
            ::..:..|.|..|:|:  ||.|.:   ..||:..|:..:...:.:.:::.:.:|:
  Rat   500 IVGLVDFVEEVNVYGV--PVPGHEGRIGMASIKMKENYEFNGKKLFQHISEYLPS 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 108/510 (21%)
Firefly_Luc_like 55..530 CDD:213279 108/510 (21%)
Slc27a2NP_113924.2 hsFATP2a_ACSVL_like 74..610 CDD:341261 108/510 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342941
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.