DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and Acsf3

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_574249.5 Gene:Acsf3 / 498962 RGDID:1586037 Length:583 Species:Rattus norvegicus


Alignment Length:540 Identity:103/540 - (19%)
Similarity:207/540 - (38%) Gaps:102/540 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 TWKDIQTNAMKVASYMRKL-GLEQGDF----VGVIGRLTTHLTALAYACFFNGTPYHALHTEYEQ 125
            |::::...::.:|..:..| |.:.||.    |..:...........:|.:.:|.....|:.::.:
  Rat    67 TYRELYDRSLCLAQEICSLRGCKVGDLQEERVSFLCSNDVSYVIAQWASWMSGGVAVPLYRKHPE 131

  Fly   126 SAIERLFGITKPRLIFCDGDEFEKVQAATKGLQVQIVTMR---NHPAGILRIQDILTTPVEMNFR 187
            :.:|.....::..::....:..|::....:.|.|.::.:.   .|.|.        ..|:|   :
  Rat   132 AQLEYFIQDSRSSVVVVGQEYLERLSPLAQRLGVPLLPLTPAVYHGAA--------EKPIE---Q 185

  Fly   188 PVRLKDGTDQLLAILSSSGTSGLPKAVTISNSHQIIGSFLPVDSSIIQYNPNTLDWASGITMTIN 252
            |::.::..|:...|..:|||:|.||...  ::|:.:.:   |.:.::.      .||    .|.|
  Rat   186 PIQEREWRDRGAMIFYTSGTTGRPKGAL--STHRNLAA---VVTGLVH------SWA----WTKN 235

  Fly   253 AAVFSLT------SIIED--CDFDPANLCGLIEKYRISMV---FVSSS--QLAMLSNCPEFYAAD 304
            ..:..:.      .::..  |.......|.::.::....|   |:||.  |:.|....|..|:..
  Rat   236 DVILHVLPLHHVHGVVNKLLCPLWVGATCVMLPEFSAQQVWEKFLSSEAPQINMFMAVPTIYSKL 300

  Fly   305 L---------------------SSVKYFFYGGSNCSLEVQNKIRSRLSNECVNFSYTLTELNSPG 348
            |                     ..::....|.:...:.:..|.:|...:..:. .|.:||:....
  Rat   301 LDYYDRHFTQSHVQDFVRAVCKERIRLMVSGSAALPVPLLEKWKSATGHTLLE-RYGMTEIGMAL 364

  Fly   349 CLNFNFDEKPNSVGRPVRGIQIKIVNE------------LGEAQGPNVV-------GEICFNNGQ 394
            .........|.|||.|:.|::::||:|            .|..:|..|.       ||:......
  Rat   365 SNPLTEARVPGSVGTPLPGVEVRIVSENPQKGSSYTIHAEGNMRGTKVTPGFEEKEGELLVKGPS 429

  Fly   395 KWPGYYKNPEETKKMQDSENWFHTGDLGYMDEDGYLFIIDRLK-DMLKYQTIMYYPSEIESVIAE 458
            .:..|:..|||||.....:.||.|||.....:|.| :|..|.. |::|.........|||..:..
  Rat   430 VFQEYWDKPEETKSAFTPDGWFRTGDTAVFKDDRY-WIRGRTSVDIIKTGGYKVSALEIERHLLA 493

  Fly   459 MPNVVEACVFGIWDPVYGDKAAASVVKKQGTQLEAQDVVEYVR-----KRIPAKFKQLNGGALIV 518
            .|::.:..|.|:.|..:|.:..|.|..::|..|..:|:.|:.|     ..:|::.       |:|
  Rat   494 HPSITDVAVIGVPDMTWGQRVTAVVALQEGHSLSHRDLKEWARGVLAPYAVPSEL-------LLV 551

  Fly   519 DHIIQSGNRKANRAATKAEF 538
            :.|.::...|.|:.....:|
  Rat   552 EAIPRNQMGKVNKKQLLQQF 571

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 103/540 (19%)
Firefly_Luc_like 55..530 CDD:213279 101/530 (19%)
Acsf3XP_574249.5 CaiC 49..572 CDD:223395 103/540 (19%)
MCS 55..564 CDD:213307 101/531 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.