DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and bgm

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001285923.1 Gene:bgm / 44117 FlyBaseID:FBgn0027348 Length:666 Species:Drosophila melanogaster


Alignment Length:465 Identity:103/465 - (22%)
Similarity:186/465 - (40%) Gaps:115/465 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    65 LTWKDIQTNAMKVASYMRKLGLEQGDFVGVIGRLTTHLTALAYAC---FFNGT-PYHA------L 119
            :|:|..:....:||....|||||:...|||          ||:.|   |::.. ..||      :
  Fly    77 VTYKQYEQKVHQVAKAFIKLGLEEHHSVGV----------LAFNCAEWFYSAMGAIHARGIIAGI 131

  Fly   120 HTEYEQSAIERLFGITKPRLIFCDG-----------DEFEKVQAATKGLQVQIVTMRNHPAGILR 173
            :|.....|::.:...:..:::..|.           |:..|::||.: :|...........|..|
  Fly   132 YTTNSADAVQHVLESSHAQIVVVDDAKQMDKIHAIRDKLPKLKAAIQ-IQEPYSPYLKKEDGYYR 195

  Fly   174 ---IQDILTTPVEMNFRPVRLKD-GTDQLLAILSSSGTSGLPKAVTISNSH---QIIGSFLPVD- 230
               |:.:..:.||..:. .||:: ..::...::.:|||.|:||.|.:|:.:   .:.|....:| 
  Fly   196 WSEIESMNVSDVEDQYM-TRLENVAINECCCLVYTSGTVGMPKGVMLSHDNITFDVRGIVKAMDR 259

  Fly   231 -----SSIIQYNPNTLDWASGITMTINAAVF---------------SLTSIIEDCDFDPANLCG- 274
                 .||:.|.|  |...:..|:.|....|               :|...::|.  .|....| 
  Fly   260 VVVGAESIVSYLP--LSHVAAQTVDIYTCAFVAGCIWFADKDALKGTLVKSLQDA--RPTRFMGV 320

  Fly   275 --LIEKYRISMVFVSSSQLAMLSNCPEFYAADLSSVKYFFYGGSNC---------SLEVQNKIRS 328
              :.||::..||.|:||. ..|......:|..::...|....|.:.         || :.:|::.
  Fly   321 PRVYEKFQERMVAVASSS-GSLKKMLASWAKGITLKHYMVSQGKSSGGFRYKIAKSL-IMSKVKQ 383

  Fly   329 RLSNECVNFSYTLTELNSP--------------------------GCLNFNFDEKP--NSVGRPV 365
            .|..:.|   .||....:|                          ||......:..  |::|:.:
  Fly   384 ALGFDRV---LTLASAAAPMSPETKKYFLSLDLKIVDAFGMSETAGCHTICLPDSVGLNTIGKTL 445

  Fly   366 RGIQIKIVNELGEAQGPNVVGEICFNNGQKWPGYYKNPEETKKMQDSENWFHTGDLGYMDEDGYL 430
            .|.:.|.:|:  :|.|.   ||:|......:.||..|.|:|::..|.:.|.|:||||::|:.||:
  Fly   446 PGCESKFINK--DANGH---GELCIRGRHVFMGYIDNKEKTEESLDDDCWLHSGDLGFVDDKGYV 505

  Fly   431 FIIDRLKDML 440
            .:..|.|:::
  Fly   506 SLTGRSKEII 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 103/465 (22%)
Firefly_Luc_like 55..530 CDD:213279 103/465 (22%)
bgmNP_001285923.1 FAA1 32..666 CDD:223953 103/465 (22%)
ACSBG_like 69..665 CDD:213299 103/465 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45452230
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24096
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.