DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and Slc27a3

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001099909.1 Gene:Slc27a3 / 295219 RGDID:1310605 Length:667 Species:Rattus norvegicus


Alignment Length:380 Identity:88/380 - (23%)
Similarity:148/380 - (38%) Gaps:77/380 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SSGTSGLPKAVTISN--------SHQIIGSFLPVDSSIIQYNPNTLDWASGI------TMTINAA 254
            :|||:|||||..:|:        .:|:.|    |....:.|....|...||.      .:.|.|.
  Rat   272 TSGTTGLPKAARVSHLKVLQCQGFYQLCG----VHQEDVIYLALPLYHMSGSLLGIVGCLGIGAT 332

  Fly   255 V-----FSLTSIIEDCDFDPANLCGLIEKYRISMVFVSSSQLAMLSNCPEFYAADLSSVKYFFYG 314
            |     ||.:...|||           :::.:::..........|.|.|...|.....|:...  
  Rat   333 VVLKPKFSASQFWEDC-----------QRHGVTVFQYIGELCRYLVNQPPSKAECGHKVRLAV-- 384

  Fly   315 GSNCSLEVQNKIRSRLSNECVNFSYTLTELNSPGCLNFNFDEKPNSVGR---------PVRGIQI 370
            ||....:..::...|.....:..:|..||.|   ...||:..:..:|||         |...|:.
  Rat   385 GSGLRPDTWDRFVRRFGPLQILETYGATEGN---VATFNYTGQQGAVGRASWLYKHIFPFSLIRY 446

  Fly   371 KIVNELGE----AQG------PNVVGEICFNNGQKWP--GYYKNPE--ETKKMQD----SENWFH 417
            .::.  ||    |||      |...|.:.....|:.|  ||...||  :.|.::|    .:.:|:
  Rat   447 DVMT--GEPIRNAQGHCMAASPGEPGLLVAPVSQESPFLGYAGAPELAQEKLLKDVFRPGDIFFN 509

  Fly   418 TGDLGYMDEDGYLFIIDRLKDMLKYQTIMYYPSEIESVIAEMPNVVEACVFGIWDPVYGDKAAAS 482
            ||||...||.|:|...||..|..:::......:|:..|:..:..:.|..::|:..|.:..:|..:
  Rat   510 TGDLLVCDEQGFLHFHDRTGDTFRWKGENVATTEVAEVLEALDFLQEVNIYGVTVPGHEGRAGMA 574

  Fly   483 VVKKQGTQLEAQDVVE---YVRKRIP----AKFKQLNGGALIVDHIIQSGNRKAN 530
            .:..:..|  |.|:|:   :|.:.:|    .:|.:|.......:...|...|.||
  Rat   575 ALALRPPQ--ALDLVQLYTHVSENLPPYARPRFLRLQESLATTETFKQQKVRMAN 627

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 88/380 (23%)
Firefly_Luc_like 55..530 CDD:213279 86/378 (23%)
Slc27a3NP_001099909.1 PRK08279 60..666 CDD:236217 88/380 (23%)
AFD_class_I 91..657 CDD:302604 88/380 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166342909
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.