DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and Dip2b

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:XP_011243931.1 Gene:Dip2b / 239667 MGIID:2145977 Length:1619 Species:Mus musculus


Alignment Length:669 Identity:119/669 - (17%)
Similarity:214/669 - (31%) Gaps:236/669 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGELQAGK---------------SPFKTRNTFDENLKIWSGGEKRSLFSPDLSIGEIIFQQMERN 50
            :|.|.|||               :....::.|...:..|     |:..:||    .::|..:...
Mouse  1002 VGNLVAGKRIAQAAGRDLGQIEENDLVRKHQFLAEILQW-----RAQATPD----HVLFMLLNAK 1057

  Fly    51 AMLTAQISVTENTELTWKDIQTNAMKVASYMRKLG-LEQGDFVGVIGRLTTHLTALAYACFFNG- 113
            .......|..:        :...|.::||.:...| |..||.|.::......|.|..|.|.:.| 
Mouse  1058 GTTVCTASCLQ--------LHKRAERIASVLGDKGHLNAGDNVVLLYPPGIELIAAFYGCLYAGC 1114

  Fly   114 -----TPYHALHTEYEQSAIERLFGITKPRLIFCDGDEFEKVQAATKGLQVQIVTMRNHPAGILR 173
                 .|.||.:.......:..:..::|...:.            |....::::..|...|.:  
Mouse  1115 IPVTVRPPHAQNLTATLPTVRMVVDVSKAACVL------------TTQTLMRLLKSREAAAAV-- 1165

  Fly   174 IQDILTTPVEMNF-------RPVRLKDGTDQLLAILS-SSGTSGLPKAVTISNSHQIIGSFLPVD 230
              |:.|.|..::.       .|...|..|.::||.|. |..|:|:...|.:|:|           
Mouse  1166 --DVKTWPAIIDTDDLPRKRLPQLYKPPTPEMLAYLDFSVSTTGMLTGVKMSHS----------- 1217

  Fly   231 SSIIQYNPNTLDWASGITMTINAAVFSLTSIIE-DCD----------FDPANLCGL--------- 275
                                   ||.:|...|: .|:          .||  .|||         
Mouse  1218 -----------------------AVNALCRAIKLQCELYSSRQIAICLDP--YCGLGFALWCLCS 1257

  Fly   276 -------------------------IEKYRISMVFVSSSQLAM----LSNCPEFY---AADLSSV 308
                                     :.:|:|...|.|.|.:.:    |.|..|..   ..:||.:
Mouse  1258 VYSGHQSVLIPPMELENNLFLWLATVNQYKIRDTFCSYSVMELCTKGLGNQVEVLKTRGINLSCI 1322

  Fly   309 KYFFYGGSNCSLEVQNKIRSRLSNECVNFSYTLTELN-SPGCLNFNFDEK--------------- 357
            :       .|.:..:.:.|..|..   :||....::. ||..::..|..:               
Mouse  1323 R-------TCVVVAEERPRVSLQQ---SFSKLFKDIGLSPRAVSTTFGSRVNVAICLQGTSGPDP 1377

  Fly   358 ----------------------PNSV-----GRPVRGIQIKIVNELGEAQGP---NVVGEICFNN 392
                                  |.|:     |:.:.|:::.|||.  |.:||   :.:|||..|:
Mouse  1378 TTVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNP--ETKGPVGDSHLGEIWVNS 1440

  Fly   393 GQKWPGYYKNPEETKKMQDSEN------------WFHTGDLGYM----------DEDGYLFIIDR 435
            .....|||...:......|..|            |..||.||::          :....|:::..
Mouse  1441 PHTASGYYTIYDSETLQADHFNTRLSFGDAAQTLWARTGYLGFVRRTELTAATGERHDALYVVGA 1505

  Fly   436 LKDMLKYQTIMYYPSEIESVIAEMPNVVEACVFGIWDPVYGDKAAASVVKKQGTQLEAQDVVEYV 500
            |.:.|:.:.:.|:|.:||:.::.:...:..|....|     ......||:..|::.||.|:|..|
Mouse  1506 LDETLELRGLRYHPIDIETSVSRVHRSIAECAVFTW-----TNLLVVVVELCGSEQEALDLVPLV 1565

  Fly   501 RKRIPAKFKQLNGGALIVD 519
            ...:..:...:.|..::||
Mouse  1566 TNVVLEEHYLIVGVVVVVD 1584

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 111/620 (18%)
Firefly_Luc_like 55..530 CDD:213279 108/600 (18%)
Dip2bXP_011243931.1 DMAP_binding 14..130 CDD:368923
Dip2 353..974 CDD:341231
Dip2 1050..1615 CDD:341231 109/612 (18%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.