DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and ACSM6

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_997204.2 Gene:ACSM6 / 142827 HGNCID:31665 Length:480 Species:Homo sapiens


Alignment Length:478 Identity:99/478 - (20%)
Similarity:168/478 - (35%) Gaps:89/478 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LQAGKSPFK-TRNTFDENLKIWSGGEKRSLFSPDLSIGEIIFQQMERNAMLTAQISVTENTELTW 67
            :||....|. .::..|:    ||..||..|..|..::.::..:..|      .:.|....|:|  
Human    42 VQAVSQNFNFAKDVLDQ----WSQLEKDGLRGPYPALWKVSAKGEE------DKWSFERMTQL-- 94

  Fly    68 KDIQTNAMKVASYMR-KLGLEQGDFVGVIGRLTTHLTALAYAC------FFNGTPYHALHTEYEQ 125
                  :.|.||.:. ...|..||.:.:|...|.....:..||      |..|:|      :...
Human    95 ------SKKAASILSDTCALSHGDRLMIILPPTPEAYWICLACVRLGITFVPGSP------QLTA 147

  Fly   126 SAIERLFGITKPRLIFCDGDEFEKVQAATKG---LQVQIVTMRNHPAGILRIQDIL-TTPVEMNF 186
            ..|.....::|.:.|..:......|.:|...   |:.:::.......|.|..:.:: ..|.:..:
Human   148 KKIRYQLRMSKAQCIVANEAMAPVVNSAVSDCPTLKTKLLVSDKSYDGWLDFKKLIQVAPPKQTY 212

  Fly   187 RPVRLKDGTDQLLAILSSSGTSGLPKAVTISNSHQIIGSFLPVDSSIIQYNPNTLDWASGITMTI 251
            ...:.:|.    :||..:.||:|.||.|..|.....:| |.......:...|..:.|:.|...  
Human   213 MRTKSQDP----MAIFFTKGTTGAPKMVEYSQYGLGMG-FSQASRRWMDLQPTDVLWSLGDAF-- 270

  Fly   252 NAAVFSLTSIIED---------C---DFDPANLCGLIEKYRISMVFVSSSQLAMLSNCPEFYAAD 304
             ....||::::..         |   .|.|..:..::.::.|:          .||..||.|...
Human   271 -GGSLSLSAVLGTWFQGACVFLCHMPTFCPETVLNVLSRFPIT----------TLSANPEMYQEL 324

  Fly   305 L----------SSVKYFFYGGSNCSLEVQNKIRSRLSNECVNFSYTLTELNSPGCLNFNFDEKPN 359
            |          .|:|.....|...|..|....: |::...:...|..||.......:.....||:
Human   325 LQHKCFTSYRFKSLKQCVAAGGPISPGVIEDWK-RITKLDIYEGYGQTETGLLCATSKTIKLKPS 388

  Fly   360 SVGRPVRGIQIKIVNELGEAQGPNVVGEICFNNGQKWPGYYKNPEETKKMQDSENW--------F 416
            |:|:|:....::||:|......|...|.|........|.....|.    |...|.:        :
Human   389 SLGKPLPPYIVQIVDENSNLLPPGEEGNIAIRIKLNQPASLYCPH----MVSWEEYASARGHMLY 449

  Fly   417 HTGDLGYMDEDGYLFIIDRLKDM 439
            .|||.|.||||||.:...|:.|:
Human   450 LTGDRGIMDEDGYFWWSGRVDDV 472

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 90/446 (20%)
Firefly_Luc_like 55..530 CDD:213279 88/426 (21%)
ACSM6NP_997204.2 AFD_class_I 45..480 CDD:302604 97/475 (20%)
AMP-binding 76..472 CDD:278902 88/438 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.