DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG5568 and acsbg1

DIOPT Version :9

Sequence 1:NP_647992.1 Gene:CG5568 / 38658 FlyBaseID:FBgn0035641 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001121495.1 Gene:acsbg1 / 100158596 XenbaseID:XB-GENE-985321 Length:254 Species:Xenopus tropicalis


Alignment Length:245 Identity:50/245 - (20%)
Similarity:90/245 - (36%) Gaps:53/245 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 PFKTRNTFDENLKIWSGGEKRSL---------FSPDLSIGEIIFQQMERNAMLTAQISVTEN--- 62
            |.||...     |:|:.....|:         .|| :::.::..:.:::...|.| :|...|   
 Frog    14 PIKTTEE-----KLWTTEANGSVQLRIDALCPQSP-ITVHQMFLESVDKYGPLDA-LSTKRNGIW 71

  Fly    63 TELTWKDIQTNAMKVASYMRKLGLEQGDFVGVIGRLTTHLTALAYACFFNGTPYHALHTEYEQSA 127
            ..:|:.|......:.|....|||||:...||::|..:......|....|.|.....::|.....|
 Frog    72 EHVTFMDYYKLCRQAAKSFLKLGLERFHSVGILGFNSEEWFISAIGTVFAGGIITGIYTTNSPEA 136

  Fly   128 IERLFGITKPRLIFCDGD-EFEKVQAATKGLQVQIVTMRNHPAGILRIQ--------DILTTPVE 183
            ...:....|..:|..:.. :.||:.....||.        |...:::.:        ::.|....
 Frog   137 CHYVASDCKMNIIVVENQKQLEKILQIWDGLP--------HLKAVVQYKGNLQEKRPNLYTWEEF 193

  Fly   184 MNFRPVRLKDGTD-------------QLLAILSSSGTSGLPKAVTISNSH 220
            |.|.    ||..|             |...::.:|||:|.||.|.:|:.:
 Frog   194 MEFG----KDIADAHLDDIINSQKANQCCVLIYTSGTTGNPKGVMLSHDN 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG5568NP_647992.1 CaiC 35..540 CDD:223395 43/211 (20%)
Firefly_Luc_like 55..530 CDD:213279 41/191 (21%)
acsbg1NP_001121495.1 AFD_class_I 66..>240 CDD:302604 39/186 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D683933at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.