DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and nrg1

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001264015.1 Gene:nrg1 / 796461 ZFINID:ZDB-GENE-050302-113 Length:730 Species:Danio rerio


Alignment Length:301 Identity:75/301 - (24%)
Similarity:134/301 - (44%) Gaps:56/301 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   327 QLAFAAPTVFQGVFKS------------MSADRRVNFSATMKVEKVYKQQHDLQLPTLVRLQFAL 379
            :||..:..||:|..:.            |:|.|:|.    ::|::|::.:               
Zfish    46 ELARRSGVVFEGKLQEEERAERNWTETPMNASRQVR----VRVQQVWQLK--------------- 91

  Fly   380 SNSSGECDIYRERLMPRGMLRSGNDLQQASDISYMMFVQQTNPGN-FTILGQPMRVTHLVVEAVE 443
              :.|   :.::.::.......|...|..:.|.||.|::.||..: ||.:..|:...    ..|.
Zfish    92 --AGG---LIKDSVVSLVWFEGGRCFQLNTGIRYMFFIEPTNDTSVFTAVFPPVETK----RTVR 147

  Fly   444 TAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEV-SGQPPPKVTWFKDEKSINRKRNIYQFK 507
            ..||:...|:....|:.:..| ..::.|||..:.||: :|.|.|.|.|:|:.|.:..|......|
Zfish   148 KDVSQVLCQDCAEPKLKNLRS-VTVEDGKKTVLKCEILAGNPAPNVKWYKNGKELTGKNKPKSIK 211

  Fly   508 HHKRR----SELIVRSFNSSSDAGRYECRAKNKASKAIAKRRI-MIKASPVHFPTDRSASGI-PC 566
            ..|::    |||::|. ::..|||.|.|.|.|...|......: :|..:....|:.:::|.: ||
Zfish   212 IKKKKQGKISELLIRK-STEGDAGLYTCEAVNSLGKTNTTANLFIINTATSTTPSAKTSSHVTPC 275

  Fly   567 N---FDYCFHNGTC---RMIPDINEVYCRCPTEYFGNRCEN 601
            |   .:||.::|.|   .:.|......||||.|:.|:||::
Zfish   276 NESEKEYCVNHGKCFTLEVTPGNIRRLCRCPNEFTGDRCQH 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 26/71 (37%)
EGF 566..598 CDD:278437 13/37 (35%)
nrg1NP_001264015.1 I-set 166..255 CDD:254352 28/90 (31%)
Ig 178..253 CDD:299845 24/75 (32%)
PHA03099 257..372 CDD:165381 18/60 (30%)
Neuregulin 333..718 CDD:280343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto40373
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11100
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2572
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.