DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and crb2a

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001038764.1 Gene:crb2a / 723994 ZFINID:ZDB-GENE-060612-1 Length:1466 Species:Danio rerio


Alignment Length:257 Identity:52/257 - (20%)
Similarity:93/257 - (36%) Gaps:74/257 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   374 RLQFALSNSSGECDIYRERLMPRGMLRSGN------DLQQASDISYMMFVQQTNPGNFTILGQPM 432
            ||.||:::.  |.|..:..::..|::...:      .|....|||..:.:.:|..|   .|| .:
Zfish  1108 RLLFAMAHP--EHDASQWFVLVDGIIDGSSAPVLAGSLNFLKDISSEVALAETFTG---CLG-AV 1166

  Fly   433 RVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEVSGQPPPKVTWFKDEKSI 497
            ||..:.:..|:.      |::.:.|:.:.:|.:.:       .:.|  .|.|..:          
Zfish  1167 RVGGVYLPFVDN------TKSPQTTRFWRRPDEHV-------HLGC--FGAPVCR---------- 1206

  Fly   498 NRKRNIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKNKASKAIAKRRI--MIKASPVHFPTDRS 560
                     .|..||....|..||      ::.|:..:.....|.::.|  .|....:|......
Zfish  1207 ---------SHPCRRGGTCVDLFN------KFGCKCPSGWEGNICEKEIDECISGPCLHGKCKDK 1256

  Fly   561 ASGIPC-------------NFD-----YCFHNGTCRMIPDINEVYCRCPTEYFGNRCENKWP 604
            .:|..|             |.|     .|.:.|||  :..:|:..|.||.:|.|.||:..:|
Zfish  1257 LNGFDCLCHPGYAGPTCSENIDDCKGSRCKNGGTC--VDGVNDFTCICPPKYSGTRCQYNYP 1316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 10/66 (15%)
EGF 566..598 CDD:278437 13/49 (27%)
crb2aNP_001038764.1 EGF_CA 32..69 CDD:238011
EGF_CA 97..133 CDD:238011
EGF_CA <144..172 CDD:238011
EGF_CA 174..210 CDD:238011
EGF_CA 212..248 CDD:238011
EGF_CA 251..286 CDD:238011
EGF_CA 288..325 CDD:238011
EGF_CA 327..363 CDD:238011
EGF_CA 365..416 CDD:238011
EGF_CA 419..455 CDD:238011
Laminin_G_2 580..714 CDD:280389
LamG 786..929 CDD:238058
EGF_CA <969..997 CDD:238011
LamG 1046..1168 CDD:238058 15/65 (23%)
EGF_CA <1208..1237 CDD:238011 8/34 (24%)
EGF_CA 1240..1273 CDD:238011 5/32 (16%)
EGF_CA 1276..1312 CDD:238011 13/37 (35%)
EGF_CA 1320..1353 CDD:238011
EGF_CA 1356..1391 CDD:238011
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.