DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and lrp1ab

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_021325646.1 Gene:lrp1ab / 565797 ZFINID:ZDB-GENE-030131-7126 Length:4562 Species:Danio rerio


Alignment Length:282 Identity:53/282 - (18%)
Similarity:95/282 - (33%) Gaps:85/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 MPRGM-----------LRSGNDLQQASDISYMMFVQQTNPGNFTILGQPMRVTHLVV-------- 439
            ||||:           ..||.|:.:.:.|        |.....|::...:...|.:|        
Zfish  3966 MPRGIAVDWVAGNLYWTDSGRDVIEVAQI--------TGQHRKTLISGMIDEPHAIVVDPQRGTM 4022

  Fly   440 --------EAVETAVSENYTQNAEVTKIFSKPSKAIIKH--------GKKLRIVCEV---SGQP- 484
                    ..:|||..:...:...|.:....|:...:.:        ..||.::..|   ...| 
Zfish  4023 YWTDWGNHPKIETAAMDGTLRQTLVHENIQWPTGLAVDYFNERLYWADSKLSVISSVRLDGSDPV 4087

  Fly   485 ------------PPKVTWFKDE-KSINRKRNIYQF---KHHKRRSELIVRSFNSSSDAGRYECRA 533
                        |..:..|:|. ..:....||. |   |..|.::|.:....|.::|...|....
Zfish  4088 VAVSNLKNNLLRPYSIDIFEDYIYGVTHTNNIV-FRVNKFGKGQAENLTTGINHATDIVLYHRYK 4151

  Fly   534 KNKASKAIAKRR-----IMIKASPV------HFPTDRSASGI--PCNFDY-------CFHNGTCR 578
            :.:.:....:::     ::..:.||      |.|.:.:...:  |..|.:       |.:.|:|.
Zfish  4152 QPEMTNPCDRKKCEWLCLLSPSGPVCICPNDHVPDNGTCVKVQPPDQFPFSPTCDLQCQNGGSCY 4216

  Fly   579 MIPDINEVYCRCPTEYFGNRCE 600
            :.| :....|||||.|.|.|||
Zfish  4217 LNP-LKNPKCRCPTSYRGERCE 4237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 16/86 (19%)
EGF 566..598 CDD:278437 12/38 (32%)
lrp1abXP_021325646.1 LDLa 36..69 CDD:197566
LDLa 81..114 CDD:197566
FXa_inhibition 170..198 CDD:317114
NHL <292..479 CDD:302697
NHL repeat 292..325 CDD:271320
LY 323..365 CDD:214531
NHL repeat 332..368 CDD:271320
LY 368..408 CDD:214531
NHL repeat 373..413 CDD:271320
NHL repeat 421..467 CDD:271320
FXa_inhibition 494..526 CDD:317114
LY 558..600 CDD:214531
LY 602..640 CDD:214531
LY 647..695 CDD:214531
LY <707..740 CDD:214531
FXa_inhibition 811..846 CDD:317114
LDLa 857..889 CDD:197566
LDLa 899..932 CDD:238060
LDLa 940..971 CDD:238060
LDLa 982..1015 CDD:238060
LDLa 1019..1052 CDD:238060
LDLa 1066..1101 CDD:238060
LDLa 1110..1144 CDD:238060
LDLa 1149..1185 CDD:238060
FXa_inhibition 1188..1224 CDD:317114
LY 1339..1381 CDD:214531
LY 1383..1426 CDD:214531
LY 1437..1470 CDD:214531
LY 1479..1515 CDD:214531
LY 1616..1652 CDD:214531
LY 1653..1696 CDD:214531
LY 1700..1739 CDD:214531
LY 1739..1780 CDD:214531
FXa_inhibition 1853..1889 CDD:317114
LY 1919..1959 CDD:214531
LY 1962..2002 CDD:214531
LY 2003..2046 CDD:214531
LY 2048..2090 CDD:214531
FXa_inhibition 2162..2197 CDD:317114
SGL 2236..2464 CDD:331563
Ldl_recept_b 2346..2387 CDD:278487
LY 2372..2413 CDD:214531
FXa_inhibition 2483..2518 CDD:317114
LDLa 2523..2559 CDD:294076
LDLa 2567..2601 CDD:238060
LDLa 2606..2640 CDD:238060
LDLa <2667..2689 CDD:238060
LDLa 2697..2731 CDD:238060
LDLa 2738..2769 CDD:197566
LDLa 2777..2810 CDD:197566
LDLa 2821..2853 CDD:197566
Ldl_recept_a 2861..2895 CDD:278486
LDLa 2908..2942 CDD:238060
cEGF 2965..2988 CDD:315355
EGF_CA 2985..3019 CDD:214542
LY 3052..3096 CDD:214531
LY 3097..3139 CDD:214531
LY 3141..3183 CDD:214531
LY 3184..3226 CDD:214531
LY 3227..3267 CDD:214531
FXa_inhibition 3297..3333 CDD:317114
LDLa 3337..3368 CDD:238060
LDLa 3377..3411 CDD:238060
LDLa 3416..3451 CDD:238060
LDLa 3455..3488 CDD:197566
LDLa 3496..3529 CDD:197566
LDLa 3539..3573 CDD:238060
LDLa 3578..3612 CDD:238060
LDLa 3616..3650 CDD:238060
LDLa 3658..3690 CDD:238060
LDLa 3699..3735 CDD:238060
LDLa 3741..3776 CDD:238060
EGF_CA 3825..3855 CDD:214542
LY 3963..3999 CDD:214531 9/40 (23%)
Ldl_recept_b 4020..4060 CDD:278487 5/39 (13%)
LY 4044..4085 CDD:214531 5/40 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.