DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and NRG1

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001309134.1 Gene:NRG1 / 3084 HGNCID:7997 Length:700 Species:Homo sapiens


Alignment Length:198 Identity:47/198 - (23%)
Similarity:76/198 - (38%) Gaps:49/198 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   421 NPGNFTILGQ-PMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEVSGQP 484
            :||.   ||| |:........:.....||.||  :.|::..|:....:...|.|..:..|.|..|
Human   113 DPGG---LGQDPIISLDATAASAVWVSSEAYT--SPVSRAQSESEVQVTVQGDKAVVSFEPSAAP 172

  Fly   485 PPKVTWFKDEKSINRKRNIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKN------KASKAIAK 543
            .||          ||   |:.|            ||..|: |..:....:|      |::.....
Human   173 TPK----------NR---IFAF------------SFLPST-APSFPSPTRNPEVRTPKSATQPQT 211

  Fly   544 RRIMIKASPVHFPTDRSASG----IPC---NFDYCFHNGTCRMIPDI---NEVYCRCPTEYFGNR 598
            ....::.:| ...|..|.:|    :.|   ...:|.:.|.|.|:.|:   :...|:||.|:.|:|
Human   212 TETNLQTAP-KLSTSTSTTGTSHLVKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDR 275

  Fly   599 CEN 601
            |:|
Human   276 CQN 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 17/72 (24%)
EGF 566..598 CDD:278437 11/37 (30%)
NRG1NP_001309134.1 PHA02887 <236..279 CDD:165214 14/43 (33%)
Neuregulin 295..688 CDD:280343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J9V
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm40289
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2572
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.