Sequence 1: | NP_523942.2 | Gene: | vn / 38657 | FlyBaseID: | FBgn0003984 | Length: | 623 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001309134.1 | Gene: | NRG1 / 3084 | HGNCID: | 7997 | Length: | 700 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 47/198 - (23%) |
---|---|---|---|
Similarity: | 76/198 - (38%) | Gaps: | 49/198 - (24%) |
- Green bases have known domain annotations that are detailed below.
Fly 421 NPGNFTILGQ-PMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEVSGQP 484
Fly 485 PPKVTWFKDEKSINRKRNIYQFKHHKRRSELIVRSFNSSSDAGRYECRAKN------KASKAIAK 543
Fly 544 RRIMIKASPVHFPTDRSASG----IPC---NFDYCFHNGTCRMIPDI---NEVYCRCPTEYFGNR 598
Fly 599 CEN 601 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vn | NP_523942.2 | IGc2 | 471..538 | CDD:197706 | 17/72 (24%) |
EGF | 566..598 | CDD:278437 | 11/37 (30%) | ||
NRG1 | NP_001309134.1 | PHA02887 | <236..279 | CDD:165214 | 14/43 (33%) |
Neuregulin | 295..688 | CDD:280343 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28J9V | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm40289 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X2572 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |