DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and Nrg1

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_006509122.1 Gene:Nrg1 / 211323 MGIID:96083 Length:884 Species:Mus musculus


Alignment Length:242 Identity:56/242 - (23%)
Similarity:92/242 - (38%) Gaps:55/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 DISYMMFVQ-QTN-----PGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAII 468
            |..|:.|:: ..|     |..|.....|:.....:.:.|...:.:.......:.::.|:.|.|  
Mouse   200 DSRYIFFMEPDANSSGRAPPAFRASFPPLETGRNLKKEVSRVLCKRCALPPRLKEMKSQESAA-- 262

  Fly   469 KHGKKLRIVCEVSGQ-PPPKVTWFKDEKSINRKRNIYQFKHHKR--RSELIVRSFNSSSDAGRYE 530
              |.||.:.||.|.: ...:..|||:...:||:......|..|:  :|||.:.. .|.:|:|.|.
Mouse   263 --GSKLVLRCETSSEYSSLRFKWFKNGNELNRRNKPQNVKIQKKPGKSELRINK-ASLADSGEYM 324

  Fly   531 CRAKNKASKAIAKRRIMI--------------------KASPVHF-----------PTDRSASG- 563
            |:..:|.....|...|.|                    ..||:..           .|..|.:| 
Mouse   325 CKVISKLGNDSASANITIVESNDLTTGMSASTERPYVSSESPIRISVSTEGANTSSSTSTSTTGT 389

  Fly   564 ---IPC---NFDYCFHNGTCRMIPDI---NEVYCRCPTEYFGNRCEN 601
               |.|   ...:|.:.|.|.|:.|:   :...|:||.|:.|:||:|
Mouse   390 SHLIKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQN 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 22/69 (32%)
EGF 566..598 CDD:278437 11/37 (30%)
Nrg1XP_006509122.1 Ig_Pro_neuregulin-1 266..340 CDD:143303 21/74 (28%)
EGF 403..433 CDD:333761 10/29 (34%)
Neuregulin 511..866 CDD:366946
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J9V
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2572
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.