| Sequence 1: | NP_523942.2 | Gene: | vn / 38657 | FlyBaseID: | FBgn0003984 | Length: | 623 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_038950018.1 | Gene: | Nrg1 / 112400 | RGDID: | 621341 | Length: | 850 | Species: | Rattus norvegicus |
| Alignment Length: | 245 | Identity: | 54/245 - (22%) |
|---|---|---|---|
| Similarity: | 87/245 - (35%) | Gaps: | 55/245 - (22%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 410 DISYMMFVQ-QTN-----PGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAII 468
Fly 469 KHGKKLRIVCEVSGQ-PPPKVTWFKDEKSINRKRNIYQFKHHKR--RSELIVRSFNSSSDAGRYE 530
Fly 531 CRAKNKASKAIAKRRIMI--------------------KASPVHF-----------PTDRSASG- 563
Fly 564 ---IPC---NFDYCFHNGTCRMIPDI---NEVYCRCPTEYFGNRCENKWP 604 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| vn | NP_523942.2 | IGc2 | 471..538 | CDD:197706 | 23/69 (33%) |
| EGF | 566..598 | CDD:278437 | 8/37 (22%) | ||
| Nrg1 | XP_038950018.1 | Ig_Pro_neuregulin-1 | 248..340 | CDD:409476 | 28/96 (29%) |
| Ig strand B | 264..268 | CDD:409476 | 1/3 (33%) | ||
| Ig strand C | 278..282 | CDD:409476 | 0/3 (0%) | ||
| Ig strand E | 306..310 | CDD:409476 | 3/3 (100%) | ||
| Ig strand F | 320..325 | CDD:409476 | 2/4 (50%) | ||
| Ig strand G | 333..336 | CDD:409476 | 1/2 (50%) | ||
| EGF_CA | <401..433 | CDD:238011 | 8/31 (26%) | ||
| Neuregulin | 478..832 | CDD:396641 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E1_28J9V | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 1 | 1.000 | - | - | otm44417 | |
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| SonicParanoid | 1 | 1.000 | - | - | X2572 | |
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 4 | 3.810 | |||||