DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and nrg3b

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_005156311.1 Gene:nrg3b / 101882495 ZFINID:ZDB-GENE-130603-38 Length:764 Species:Danio rerio


Alignment Length:54 Identity:18/54 - (33%)
Similarity:24/54 - (44%) Gaps:6/54 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   557 TDRSASGIPC----NFDYCFHNGTCRMIPDINEV--YCRCPTEYFGNRCENKWP 604
            |.||....||    ...:|.:.|.|.:|..:..|  :|||...|.|.||:...|
Zfish   293 TVRSEFFKPCQDSQEMAFCLNEGECFIIETVAGVHRHCRCKEGYRGLRCDQFVP 346

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706
EGF 566..598 CDD:278437 11/37 (30%)
nrg3bXP_005156311.1 Neuregulin 369..>410 CDD:280343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - LDO PTHR11100
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.