powered by:
Protein Alignment vn and nrg3b
DIOPT Version :9
Sequence 1: | NP_523942.2 |
Gene: | vn / 38657 |
FlyBaseID: | FBgn0003984 |
Length: | 623 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_005156311.1 |
Gene: | nrg3b / 101882495 |
ZFINID: | ZDB-GENE-130603-38 |
Length: | 764 |
Species: | Danio rerio |
Alignment Length: | 54 |
Identity: | 18/54 - (33%) |
Similarity: | 24/54 - (44%) |
Gaps: | 6/54 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 557 TDRSASGIPC----NFDYCFHNGTCRMIPDINEV--YCRCPTEYFGNRCENKWP 604
|.||....|| ...:|.:.|.|.:|..:..| :|||...|.|.||:...|
Zfish 293 TVRSEFFKPCQDSQEMAFCLNEGECFIIETVAGVHRHCRCKEGYRGLRCDQFVP 346
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
vn | NP_523942.2 |
IGc2 |
471..538 |
CDD:197706 |
|
EGF |
566..598 |
CDD:278437 |
11/37 (30%) |
nrg3b | XP_005156311.1 |
Neuregulin |
369..>410 |
CDD:280343 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR11100 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.010 |
|
Return to query results.
Submit another query.