DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment vn and notch2

DIOPT Version :9

Sequence 1:	NP_523942.2	Gene:	vn / 38657	FlyBaseID:	FBgn0003984	Length:	623	Species:	Drosophila melanogaster
Sequence 2:	XP_002939126.3	Gene:	notch2 / 100486344	XenbaseID:	XB-GENE-6046917	Length:	2455	Species:	Xenopus tropicalis

Alignment Length:	36	Identity:	11/36 - (30%)
Similarity:	19/36 - (52%)	Gaps:	0/36 - (0%)

- Green bases have known domain annotations that are detailed below.

  Fly   565 PCNFDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCE 600
            ||....|.:.|||::..|:::..|.|...:.|..|:
Frog    63 PCQETICLNGGTCKVSSDLSKGVCTCAPGFGGENCK 98

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
vn	NP_523942.2	IGc2	471..538	CDD:197706
vn	NP_523942.2	EGF	566..598	CDD:278437	9/31 (29%)
notch2	XP_002939126.3	EGF_CA	141..176	CDD:238011
		EGF_CA	178..215	CDD:238011
		EGF_CA	256..292	CDD:238011
		EGF_CA	294..331	CDD:238011
		EGF_CA	334..369	CDD:238011
		EGF_CA	411..450	CDD:238011
		EGF_CA	452..488	CDD:238011
		EGF_CA	491..526	CDD:238011
		EGF_CA	528..564	CDD:238011
		EGF_CA	566..600	CDD:238011
		EGF_CA	604..639	CDD:238011
		EGF_CA	641..676	CDD:238011
		EGF_CA	678..713	CDD:238011
		EGF_CA	717..751	CDD:238011
		EGF_CA	753..789	CDD:238011
		EGF_CA	791..827	CDD:238011
		EGF_CA	869..905	CDD:238011
		EGF_CA	907..943	CDD:238011
		EGF_CA	945..980	CDD:238011
		EGF_CA	983..1018	CDD:238011
		EGF_CA	1022..1057	CDD:238011
		EGF_CA	1147..1181	CDD:238011
		EGF_CA	1184..1219	CDD:238011
		EGF_CA	1221..1261	CDD:238011
		EGF_CA	1263..1301	CDD:238011
		EGF_CA	<1311..1342	CDD:238011
		Notch	1430..1456	CDD:395019
		Notch	1469..1497	CDD:395019
		Notch	1506..1535	CDD:395019
		NOD	1541..1595	CDD:399654
		NODP	1621..1676	CDD:400155
		JMTM_Notch_APP	1661..1742	CDD:425406
		PHA03095	<1822..>2032	CDD:222980
		ANK repeat	1829..1876	CDD:293786
		ANK repeat	1879..1909	CDD:293786
		ANK repeat	1911..1976	CDD:293786
		ANK repeat	1978..2009	CDD:293786
		PTZ00322	1984..>2086	CDD:140343
		ANK repeat	2011..2042	CDD:293786
		DUF3454	2371..2431	CDD:403221
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.910