DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and nrg2b

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_005157176.1 Gene:nrg2b / 100270726 ZFINID:ZDB-GENE-090205-2 Length:705 Species:Danio rerio


Alignment Length:300 Identity:75/300 - (25%)
Similarity:128/300 - (42%) Gaps:55/300 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   319 YCSARDPAQ-LAFAAPTVFQGVFKSMSADRRVN-FSATMKVEKVYKQQHDLQLPTLVRLQFALSN 381
            |..:.|..| .|:.:..|.:|...|:..:..|. :|..:.|..|:        |.         |
Zfish    21 YAPSLDSLQDQAYRSAVVIEGKVSSLPENVSVEPYSVNVTVLYVW--------PV---------N 68

  Fly   382 SSGECDIYRERLMPRGMLRSGNDLQQASDI------SYMMFVQQT-NPGNFTILGQPMRVTHLVV 439
            |.|   :.||:|:..|...|     :|..:      :|:.|:..| .|..|.....|:..|...:
Zfish    69 SGG---LRREQLVTVGEFGS-----EAPCVAVEKHHTYIFFMDPTEEPLVFKASFAPLDSTEKTL 125

  Fly   440 EA-VETAVSENYTQNAEVTKIFSKPSKAIIKHGKKLRIVCEVSGQPPPKVTWFKDEKSINRKRNI 503
            :. ||:.:.::.....:|..:.|:    .::.||||.:.||..|.|.|...|:||...:.:|:.:
Zfish   126 KKDVESVLCKDCASAPKVKPMDSQ----WLQEGKKLTLKCEAVGNPSPSFNWYKDGSQLRQKKTV 186

  Fly   504 YQFKHHKRRSELIVRSFNSSSDAGRYECRAKN-----KASKAIAKRRIMIKASPVHFPTDRSASG 563
             :.|.:|:.|:|.:.... ..|:|.|.|..:|     .|:..::.:.|....||      .|:..
Zfish   187 -KIKTNKKNSKLHISKVR-LEDSGNYTCVVENSLGRENATSFVSVQSITTTLSP------GSSHA 243

  Fly   564 IPCN---FDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCE 600
            ..||   ..||.:.|.|..|..||::.|:||.:|.|.||:
Zfish   244 RKCNETEKTYCINGGDCYFIHGINQLSCKCPNDYTGERCQ 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 22/71 (31%)
EGF 566..598 CDD:278437 14/34 (41%)
nrg2bXP_005157176.1 I-set 143..229 CDD:254352 25/91 (27%)
Ig 157..227 CDD:299845 20/71 (28%)
PHA02887 <192..283 CDD:165214 28/97 (29%)
Neuregulin 301..690 CDD:280343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J9V
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11100
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2572
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.