DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and nrg2a

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_005161385.1 Gene:nrg2a / 100006951 ZFINID:ZDB-GENE-070615-10 Length:710 Species:Danio rerio


Alignment Length:307 Identity:78/307 - (25%)
Similarity:133/307 - (43%) Gaps:73/307 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 AFAAPTVFQGVFKSMSADRRVN---FSATMKVEKVYKQQHDLQLPTLVRLQFALSNSSGECDIYR 390
            |:.:..|.:|  |..||.:.|:   :|..:||..|:.:                 ||.|   :.|
Zfish    32 AYRSAVVIEG--KVQSAPQNVSAEPYSVNVKVLDVWPR-----------------NSGG---LER 74

  Fly   391 ERLMPRGMLRSGNDLQQA-SDISYMMFVQQTNPGNFTILGQPMRVTHLVVEA----VETAVSENY 450
            |:|:..|...|.....:. .:..|:.|:..|:        :|     ||.:|    ::|: .:|.
Zfish    75 EQLVTVGEFGSEAPCTKVKKNHKYIFFMDPTD--------EP-----LVFKASFAPLDTS-GKNL 125

  Fly   451 TQNAEVTKIFSK-----PSKAIIKH------GKKLRIVCEVSGQPPPKVTWFKDEKSINRKRNIY 504
            .:  :|.:|..:     ||...:|:      |.:|.:.||.:|.|.|:..|:||...:.|.:.| 
Zfish   126 KK--DVGRILCEDCAAFPSLRRMKNPVLADEGSRLIVKCEATGSPAPEYKWYKDGAELKRSKEI- 187

  Fly   505 QFKHHKRRSELIVRSFNSSSDAGRYECRAKNKASKA-----IAKRRIMIKASPVHFPTDRSASGI 564
            :.:::|:.|::.:.| ....|:|.|.|.|:|...||     :..:.|....||      .|....
Zfish   188 KIRNNKKNSKVQIGS-AKLEDSGNYTCVAENILGKANGTSTVHVQSITTTVSP------GSGHAR 245

  Fly   565 PCN---FDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCENKWPDSRY 608
            .||   ..||.:.|.|..|..||::.|:||.:|.|:||:.....|.|
Zfish   246 RCNDTEKTYCVNGGDCYYIHGINQLSCKCPNDYTGDRCQTSVMASFY 292

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 21/66 (32%)
EGF 566..598 CDD:278437 14/34 (41%)
nrg2aXP_005161385.1 IG_like 149..230 CDD:214653 23/82 (28%)
Ig_Pro_neuregulin 158..228 CDD:143227 22/71 (31%)
PHA03099 220..341 CDD:165381 24/79 (30%)
Neuregulin 302..698 CDD:280343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_28J9V
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11100
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R8848
SonicParanoid 1 1.000 - - X2572
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.940

Return to query results.
Submit another query.