DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and MAD2

DIOPT Version :9

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_012504.3 Gene:MAD2 / 853422 SGDID:S000003567 Length:196 Species:Saccharomyces cerevisiae


Alignment Length:196 Identity:70/196 - (35%)
Similarity:122/196 - (62%) Gaps:7/196 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFLQNVLSQTEEW 75
            |:||||.:.:.|:.:|.|||||:|||:||||||...::|.||:|.:.|.::|.:::.:|.|...|
Yeast     5 ISLKGSTRTVTEFFEYSINSILYQRGVYPAEDFVTVKKYDLTLLKTHDDELKDYIRKILLQVHRW 69

  Fly    76 LSKNMINKISMVITNAHTKEVLECWDFNMQAELGDGDISDPTKATTTKELSRIQNEIRDVMRQIS 140
            |.....|::.:.|.:....||:|.|.||:|...|:.:..|     ...:|:..|::||.::|||:
Yeast    70 LLGGKCNQLVLCIVDKDEGEVVERWSFNVQHISGNSNGQD-----DVVDLNTTQSQIRALIRQIT 129

  Fly   141 ATVSYLPLL--DCICTFDIMIHTLQNTELPAKWDETGAIVIQNPQAVQLRSFSTGLHKVDTVVNY 203
            ::|::||.|  :...||.::.:|..:.::|.:|.::.:..|.:.:.||.::|||..|||...|:|
Yeast   130 SSVTFLPELTKEGGYTFTVLAYTDADAKVPLEWADSNSKEIPDGEVVQFKTFSTNDHKVGAQVSY 194

  Fly   204 K 204
            |
Yeast   195 K 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 13..195 CDD:280464 63/183 (34%)
MAD2NP_012504.3 HORMA 10..186 CDD:396743 60/180 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343242
Domainoid 1 1.000 108 1.000 Domainoid score I1422
eggNOG 1 0.900 - - E1_KOG3285
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1768
Inparanoid 1 1.050 136 1.000 Inparanoid score I1212
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53959
OrthoFinder 1 1.000 - - FOG0005018
OrthoInspector 1 1.000 - - oto99859
orthoMCL 1 0.900 - - OOG6_103574
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R677
SonicParanoid 1 1.000 - - X4198
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.