DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and MAD2

DIOPT Version :9

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_189227.1 Gene:MAD2 / 822195 AraportID:AT3G25980 Length:209 Species:Arabidopsis thaliana


Alignment Length:205 Identity:82/205 - (40%)
Similarity:128/205 - (62%) Gaps:8/205 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 STAQATKNCITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFLQ 66
            |...|.|:.|||.|||.|:.|:..|..||||:.|.:||.|.|...::|||.:|:.:|..:|:|:.
plant     3 SKTAAAKDIITLHGSAAIVSEFFCYAANSILYNRAVYPEESFVKVKKYGLPMLLIEDESVKSFMS 67

  Fly    67 NVLSQTEEWLSKNMINKISMVITNAHTKEVLECWDFNMQAELGDGDISDP--TKATTTKELSRIQ 129
            |:.||..|||....:.::.:||.:..|.||||.|:|.::.   |.::.|.  ::..:.||:.|  
plant    68 NLTSQISEWLEAGKLQRVVLVIMSKATGEVLERWNFRIET---DNEVVDKGVSREKSDKEIMR-- 127

  Fly   130 NEIRDVMRQISATVSYLPLLDCICTFDIMIHTLQNTELPAKWDETGAIVIQNPQAVQLRSFSTGL 194
             ||:.:|||::::|:|||.||..|.||::.:|..:..:|..|.|:...:|.|||.|:|..|.|.:
plant   128 -EIQAIMRQVASSVTYLPCLDETCVFDVLAYTDTDVAVPFTWIESDPKLIANPQMVKLHGFDTKI 191

  Fly   195 HKVDTVVNYK 204
            |||||:|:||
plant   192 HKVDTLVSYK 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 13..195 CDD:280464 69/183 (38%)
MAD2NP_189227.1 HORMA 17..192 CDD:396743 67/180 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 136 1.000 Domainoid score I1602
eggNOG 1 0.900 - - E1_KOG3285
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1768
Inparanoid 1 1.050 162 1.000 Inparanoid score I1618
OMA 1 1.010 - - QHG53959
OrthoDB 1 1.010 - - D1197019at2759
OrthoFinder 1 1.000 - - FOG0005018
OrthoInspector 1 1.000 - - oto3368
orthoMCL 1 0.900 - - OOG6_103574
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.