DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and mad2l1

DIOPT Version :9

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001017739.1 Gene:mad2l1 / 550434 ZFINID:ZDB-GENE-030515-3 Length:202 Species:Danio rerio


Alignment Length:194 Identity:89/194 - (45%)
Similarity:136/194 - (70%) Gaps:4/194 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 ITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFLQNVLSQTEEW 75
            |||||||:::.|:..:||||||:||||||||.|....||.:::.::.|.|:|.:|.||:||.:||
Zfish     8 ITLKGSAELVAEFFSFGINSILYQRGIYPAETFTRVTQYDMSLQLTTDTKLKNYLTNVISQLKEW 72

  Fly    76 LSKNMINKISMVITNAHTKEVLECWDFNMQAELGDGDISDPTKATTTKELSRIQNEIRDVMRQIS 140
            |.:..:.|:.:|||...|.||||.|.|::|.:....:.|.|.:    |.:..||.|||.|:|||:
Zfish    73 LFECTVQKLVVVITCLETNEVLERWQFDIQCDKTAKESSAPRE----KSIKAIQEEIRSVIRQIT 133

  Fly   141 ATVSYLPLLDCICTFDIMIHTLQNTELPAKWDETGAIVIQNPQAVQLRSFSTGLHKVDTVVNYK 204
            |||::||||:..|..|::|:|.::.|:|.:|:|:|..:|...:.|:||||:|.:|||:::|.||
Zfish   134 ATVTFLPLLETACALDLLIYTDKDLEVPEQWEESGPQLIDQSEEVRLRSFTTSIHKVNSMVAYK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 13..195 CDD:280464 81/181 (45%)
mad2l1NP_001017739.1 HORMA 10..188 CDD:280464 81/181 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578993
Domainoid 1 1.000 154 1.000 Domainoid score I4234
eggNOG 1 0.900 - - E1_KOG3285
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1768
Inparanoid 1 1.050 188 1.000 Inparanoid score I3902
OMA 1 1.010 - - QHG53959
OrthoDB 1 1.010 - - D1197019at2759
OrthoFinder 1 1.000 - - FOG0005018
OrthoInspector 1 1.000 - - oto40249
orthoMCL 1 0.900 - - OOG6_103574
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R677
SonicParanoid 1 1.000 - - X4198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.