DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and MAD2L1

DIOPT Version :10

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_002349.1 Gene:MAD2L1 / 4085 HGNCID:6763 Length:205 Species:Homo sapiens


Alignment Length:142 Identity:25/142 - (17%)
Similarity:40/142 - (28%) Gaps:63/142 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly    98 LLTPRASKDVPSSFRFPPMTKKPQWWWRTLACLPYLMPLHETWMYAETAYHLHPFLEDFEFLTYP 162
            :|.|...|||         |:.|                 |.....:..|....||         
Human   208 VLDPSGYKDV---------TQDP-----------------EVMEVLQNLYRTKSFL--------- 237

  Fly   163 FLGAIGRLPSWFLMAYFFVA---------YLGIVRRKEWPHFFR------------------FHV 200
            |:|....|......|.|..:         |:.:::..| .|||:                  |.:
Human   238 FVGCGETLRDQIFQALFLYSVPNKVDLEHYMVVLKENE-DHFFKHQADMLLHGIKVVSYGDCFDL 301

  Fly   201 VMGMLLEIALQV 212
            ..|.:.::|.|:
Human   302 FPGYVQDLATQI 313

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 16..195 CDD:460526 18/105 (17%)
MAD2L1NP_002349.1 HORMA 16..191 CDD:460526
Required for assuming the closed conformation and for interaction with CDC20 195..205
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.