DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and Mad2l1

DIOPT Version :9

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001100064.1 Gene:Mad2l1 / 297176 RGDID:1310889 Length:205 Species:Rattus norvegicus


Alignment Length:212 Identity:93/212 - (43%)
Similarity:141/212 - (66%) Gaps:20/212 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTAQATKNCITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFL 65
            |:...|....|||:|||:|:.|:..:||||||:||||||:|.|...|:||||:|::.||::..:|
  Rat     1 MAQQLARDQGITLRGSAEIVAEFFSFGINSILYQRGIYPSETFTRVQKYGLTLLVTTDPELIKYL 65

  Fly    66 QNVLSQTEEWLSKNMINKISMVITNAHTKEVLECWDFNMQAELGDGDISDPTKATTTKE------ 124
            .||:.|.:|||.|..:.|:.:||:|..:.||||.|.|:::.:            .|.||      
  Rat    66 NNVVEQLKEWLYKCSVQKLVVVISNIESGEVLERWQFDIECD------------KTAKEEGVRRE 118

  Fly   125 --LSRIQNEIRDVMRQISATVSYLPLLDCICTFDIMIHTLQNTELPAKWDETGAIVIQNPQAVQL 187
              ...||:|||.|:|||:|||::||||:..|:||::|:|.::..:|.||:|:|...|.|.:.|:|
  Rat   119 KSQKAIQDEIRSVIRQITATVTFLPLLEVSCSFDLLIYTDKDLVVPEKWEESGPQFITNSEEVRL 183

  Fly   188 RSFSTGLHKVDTVVNYK 204
            |||:|.:|||:::|.||
  Rat   184 RSFTTTIHKVNSMVAYK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 13..195 CDD:280464 83/189 (44%)
Mad2l1NP_001100064.1 HORMA 16..191 CDD:396743 81/186 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339297
Domainoid 1 1.000 154 1.000 Domainoid score I4176
eggNOG 1 0.900 - - E1_KOG3285
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1768
Inparanoid 1 1.050 185 1.000 Inparanoid score I3850
OMA 1 1.010 - - QHG53959
OrthoDB 1 1.010 - - D1197019at2759
OrthoFinder 1 1.000 - - FOG0005018
OrthoInspector 1 1.000 - - oto97644
orthoMCL 1 0.900 - - OOG6_103574
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X4198
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1615.770

Return to query results.
Submit another query.