DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and mad2

DIOPT Version :9

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_596370.1 Gene:mad2 / 2540589 PomBaseID:SPBC20F10.06 Length:203 Species:Schizosaccharomyces pombe


Alignment Length:207 Identity:82/207 - (39%)
Similarity:141/207 - (68%) Gaps:6/207 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSTAQATKNCITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFL 65
            ||:.....| .:||||::::.|:.:|.:|||||||||||||||...::|||.:|:|.|.::||::
pombe     1 MSSVPIRTN-FSLKGSSKLVSEFFEYAVNSILFQRGIYPAEDFKVVRKYGLNMLVSVDEEVKTYI 64

  Fly    66 QNVLSQTEEWLSKNMINKISMVITNAHTKEVLECWDFNMQAELGDGDISDPTKATTTKELS-RIQ 129
            :.::||..:|:....|.|:.:|||:..:.|.||.|.||::..    |.:|..:....||.. |:|
pombe    65 RKIVSQLHKWMFAKKIQKLILVITSKCSGEDLERWQFNVEMV----DTADQFQNIGNKEDELRVQ 125

  Fly   130 NEIRDVMRQISATVSYLPLLDCICTFDIMIHTLQNTELPAKWDETGAIVIQNPQAVQLRSFSTGL 194
            .||:.::|||:|||::||.|:..|||:::::..:::|:|..|.::...::::.:.||||||||.:
pombe   126 KEIQALIRQITATVTFLPQLEEQCTFNVLVYADKDSEVPTDWVDSDPRILRDAEQVQLRSFSTSM 190

  Fly   195 HKVDTVVNYKMS 206
            ||:|..|.|:::
pombe   191 HKIDCQVAYRVN 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 13..195 CDD:280464 74/182 (41%)
mad2NP_596370.1 HORMA 12..191 CDD:280464 71/179 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 150 1.000 Domainoid score I1105
eggNOG 1 0.900 - - E1_KOG3285
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1768
Inparanoid 1 1.050 166 1.000 Inparanoid score I1215
OMA 1 1.010 - - QHG53959
OrthoFinder 1 1.000 - - FOG0005018
OrthoInspector 1 1.000 - - oto101546
orthoMCL 1 0.900 - - OOG6_103574
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R677
SonicParanoid 1 1.000 - - X4198
TreeFam 1 0.960 - -
1413.860

Return to query results.
Submit another query.