DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and mdf-2

DIOPT Version :9

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001023563.1 Gene:mdf-2 / 177046 WormBaseID:WBGene00003161 Length:203 Species:Caenorhabditis elegans


Alignment Length:200 Identity:89/200 - (44%)
Similarity:139/200 - (69%) Gaps:7/200 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TKNCITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFLQNVLSQ 71
            |:|.|:||||||::.|:..:|:||||:||.:||::.|...::||||:.::.:.|::.|:..:|.|
 Worm     6 TQNAISLKGSAQLVKEFFHFGLNSILYQRALYPSDSFKREKKYGLTLWVAHEKKLQAFMDPLLQQ 70

  Fly    72 TEEWLSKNMINKISMVITNAHTKEVLECWDFNMQAE--LGDGDISDPTKATTTKELSRIQNEIRD 134
            .|.||:|..:.::.|||:...||||:|.|.|::..|  ..:|:     .|...||..:|:.||.|
 Worm    71 VEYWLAKRQLKRLVMVISEVKTKEVVERWQFDIHTENLAEEGE-----NAHRVKEEKKIRQEISD 130

  Fly   135 VMRQISATVSYLPLLDCICTFDIMIHTLQNTELPAKWDETGAIVIQNPQAVQLRSFSTGLHKVDT 199
            |:|||:|:||:||||:...:||::|:|.::|:.|..|.|:||.:|||.:.||||||||.:|.|:|
 Worm   131 VIRQITASVSFLPLLEEPVSFDVLIYTGKDTQAPEDWTESGACLIQNSETVQLRSFSTSVHSVNT 195

  Fly   200 VVNYK 204
            .|.||
 Worm   196 NVQYK 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 13..195 CDD:280464 80/183 (44%)
mdf-2NP_001023563.1 HORMA 15..191 CDD:367025 77/180 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158646
Domainoid 1 1.000 163 1.000 Domainoid score I2416
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1768
Inparanoid 1 1.050 184 1.000 Inparanoid score I2621
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53959
OrthoDB 1 1.010 - - D1197019at2759
OrthoFinder 1 1.000 - - FOG0005018
OrthoInspector 1 1.000 - - oto19560
orthoMCL 1 0.900 - - OOG6_103574
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R677
SonicParanoid 1 1.000 - - X4198
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1413.940

Return to query results.
Submit another query.