DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment mad2 and mad2l1

DIOPT Version :9

Sequence 1:NP_647991.1 Gene:mad2 / 38656 FlyBaseID:FBgn0035640 Length:207 Species:Drosophila melanogaster
Sequence 2:NP_001096528.1 Gene:mad2l1 / 100125170 XenbaseID:XB-GENE-947153 Length:203 Species:Xenopus tropicalis


Alignment Length:202 Identity:92/202 - (45%)
Similarity:140/202 - (69%) Gaps:9/202 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QATKNCITLKGSAQIIVEYLKYGINSILFQRGIYPAEDFNNTQQYGLTILMSKDPKIKTFLQNVL 69
            |.|:..|||||||:|:.|:...||||||:||||||:|.|...|:||||:|::.||.:|.:|..|.
 Frog     4 QLTREGITLKGSAEIVSEFFFCGINSILYQRGIYPSETFTRIQKYGLTLLLTTDPGLKEYLNKVT 68

  Fly    70 SQTEEWLSKNMINKISMVITNAHTKEVLECWDFNMQAE--LGDGDISDPTKATTTKELSRIQNEI 132
            .|.::||.|..:.|:.:|||:..:.|:||.|.|:::.:  :.||.:.:       |....||.||
 Frog    69 DQLKDWLYKCQVQKLVVVITSIDSNEILERWQFDIECDKTVKDGIVRE-------KSQKVIQEEI 126

  Fly   133 RDVMRQISATVSYLPLLDCICTFDIMIHTLQNTELPAKWDETGAIVIQNPQAVQLRSFSTGLHKV 197
            |.|:|||:|||::||||:..|.||::|:|.::.|:|.||:|:|...:.|.:.|:||||:|.:|||
 Frog   127 RSVIRQITATVTFLPLLETACAFDLLIYTDKDLEVPEKWEESGPQFVSNSEEVRLRSFTTTIHKV 191

  Fly   198 DTVVNYK 204
            :::|.||
 Frog   192 NSMVAYK 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
mad2NP_647991.1 HORMA 13..195 CDD:280464 82/183 (45%)
mad2l1NP_001096528.1 HORMA 15..189 CDD:367025 79/180 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4457
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H1768
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53959
OrthoDB 1 1.010 - - D1197019at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - oto104330
Panther 1 1.100 - - LDO PTHR11842
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R677
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1010.060

Return to query results.
Submit another query.