DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and DAS2

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_010303.3 Gene:DAS2 / 851583 SGDID:S000002427 Length:232 Species:Saccharomyces cerevisiae


Alignment Length:194 Identity:35/194 - (18%)
Similarity:73/194 - (37%) Gaps:46/194 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 QEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGS-----NLKLLECNSQVAELLTILRDKNTTRS 86
            ::|.|:::.:.:....||....|.:.::...:.|     |::::..::.:...:     |:...:
Yeast     3 RKAVEEKRIVISIGGGHATGVGAIALDLQNTFKSLYNSINIRVINLDNMIEGNI-----KSYNNN 62

  Fly    87 DFKFYADRLIRLVIEES--LNQLPYTHCDVETPTGAIYEGLKYRSGNCGVSIIRSGEAMEQGLRD 149
            |:.|  |.::.||.|:.  .:|......|.|.|...|..        ||...:......|     
Yeast    63 DYDF--DNILNLVYEKHAVTSQNDMIQHDYEDPIDLIIV--------CGCYALYDKRINE----- 112

  Fly   150 CCRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMYPIMSTGNTVLQAVNVLREHGVPE 213
                |...|:.::|||   :.|::......::||.:.|            .|.:....:|..||
Yeast   113 ----ISQLKVFLDSDA---DKRLISLIKKKNVGSNEQL------------AQLITEYMDHLRPE 157

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 28/146 (19%)
DAS2NP_010303.3 Udk 8..209 CDD:223645 33/189 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.