DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and UKL3

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001323275.1 Gene:UKL3 / 842031 AraportID:AT1G55810 Length:488 Species:Arabidopsis thaliana


Alignment Length:257 Identity:99/257 - (38%)
Similarity:138/257 - (53%) Gaps:44/257 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 QQLHTPTHAHAAVPAATSEEILAEYGSNLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRL 98
            |.:||....|.          |.:...||.:::...|:..:.|::||..||:.||.||:||||||
plant   239 QHIHTKLGQHD----------LCKIYPNLYVIQSTFQIRGMHTLIRDSKTTKHDFIFYSDRLIRL 293

  Fly    99 VIEESLNQLPYTHCDVETPTGAIYEGLKYRSGNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVES 163
            |:|..|..||:|...|.||||::|.|:.:....||||:|||||:||..||.||:.|:|||||:..
plant   294 VVEHGLGHLPFTEKQVVTPTGSVYSGVDFCKKLCGVSVIRSGESMENALRACCKGIKIGKILIHR 358

  Fly   164 DAN-----------------------THEARVVYARFPDDIGSRQVLLMYPIMSTGNTVLQAVNV 205
            :.:                       ||:  ::|.:.|.||..|.|||:.||:.|||:.:||:.:
plant   359 EGDNGQQVCVLSLLITSPNYLLTTNGTHQ--LIYEKLPSDISERHVLLLDPILGTGNSAVQAIRL 421

  Fly   206 LREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSELH-------PVAP--NHFGQKYF 258
            |...|||||.||..||...|.....|...||::||:|||:.       .|.|  ..||.:||
plant   422 LISKGVPESNIIFLNLISAPEGVNVVCKKFPRIKIVTSEIELGLNDEFRVVPGMGEFGDRYF 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 85/197 (43%)
UKL3NP_001323275.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.