DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and UKL4

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001320072.1 Gene:UKL4 / 828757 AraportID:AT4G26510 Length:469 Species:Arabidopsis thaliana


Alignment Length:207 Identity:92/207 - (44%)
Similarity:129/207 - (62%) Gaps:10/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 NLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGL 125
            ||.::....|:..:.|::||..||:.||.||:|||||||:|..|..||:|...|.||||.:|.|:
plant   259 NLYVIHSTFQIRGMHTLIRDSQTTKHDFVFYSDRLIRLVVEHGLGHLPFTEKQVITPTGCVYSGV 323

  Fly   126 KYRSGNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMY 190
            .:....||||:|||||:||..||.||:.|:|||||:..:.:..: ::||.:.|:||..|.|||:.
plant   324 DFCKRLCGVSVIRSGESMENALRACCKGIKIGKILIHREGDNGQ-QLVYEKLPNDISERHVLLLD 387

  Fly   191 PIMSTGNTVLQAVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSEL-------HPV 248
            ||:.|||:.::|:|:|...||||..||..||...|.....|...||::||:|||:       ..|
plant   388 PILGTGNSAVEAINLLISKGVPEGNIIFLNLISAPQGVHVVCKKFPRIKIVTSEIDNGLNEEFRV 452

  Fly   249 AP--NHFGQKYF 258
            .|  ..||.:||
plant   453 IPGMGEFGDRYF 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 83/174 (48%)
UKL4NP_001320072.1 UMPK 51..244 CDD:238981
UPRTase 265..466 CDD:405383 90/201 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.920

Return to query results.
Submit another query.