DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and UPP

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_190958.1 Gene:UPP / 824557 AraportID:AT3G53900 Length:296 Species:Arabidopsis thaliana


Alignment Length:209 Identity:53/209 - (25%)
Similarity:95/209 - (45%) Gaps:7/209 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AAVPAATSEEILAEYGSN--LKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVI-EESLN 105
            |....|.||..:  .|||  |..:..:..:...:::||::.|....|:.....|.||:: |.|..
plant    62 ARTKMAASEASI--NGSNRMLVFVPPHPLIKHWISVLRNEQTPCPVFRNAIAELGRLLMYEASRE 124

  Fly   106 QLPYTHCDVETPTG-AIYEGLKYRSGNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHE 169
            .||....::.:|.| |..|.:..|.....|.|:|:|.|:.:.......:.:|..:.|..|..|..
plant   125 WLPTVVGEIMSPMGPASVEFIDPREPIAVVPILRAGLALAEHASSVLPANKIYHLGVSRDEKTLL 189

  Fly   170 ARVVYARFPDDI-GSRQVLLMYPIMSTGNTVLQAVNVLREHGVPESCIILSNLFCTPIAARTVVN 233
            ..|...:.||:. .:.:|.|:.|:::||.|::.|:::|:|.|:....|.:......|.|...:..
plant   190 PSVYLNKLPDEFPKNSRVFLVDPVLATGGTIMAAMDLLKERGLSVQQIKVICAIAAPPALSKLNE 254

  Fly   234 AFPKLKILTSELHP 247
            .||.|.:....:.|
plant   255 KFPGLHVYAGIIDP 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 44/177 (25%)
UPPNP_190958.1 PLN02541 48..291 CDD:215297 53/209 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 52 1.000 Inparanoid score I2621
OMA 1 1.010 - - QHG53753
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
54.830

Return to query results.
Submit another query.