DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and UKL5

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_189380.1 Gene:UKL5 / 822365 AraportID:AT3G27440 Length:465 Species:Arabidopsis thaliana


Alignment Length:213 Identity:90/213 - (42%)
Similarity:129/213 - (60%) Gaps:10/213 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 LAEYGSNLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTG 119
            |.:..||:.::....|:..:.|::||.|||:.||.||||||||||:|..|..||:|...:.||||
plant   234 LCKIYSNIFIISSTFQIKGMHTLIRDINTTKHDFVFYADRLIRLVVEHGLGHLPFTEKQITTPTG 298

  Fly   120 AIYEGLKYRSGNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSR 184
            ::|.|:.:....||||:|||||:||..||.||..|:|||||:..: |....:::|.:.|.||.||
plant   299 SVYTGVDFCKRLCGVSVIRSGESMENALRACCNGIKIGKILIHRE-NNDGRQLIYEKLPKDISSR 362

  Fly   185 QVLLMYPIMSTGNTVLQAVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSELHP-- 247
            .|.|:.|::::|.:.::|:.:|...|||||.||..||...|.....:...||.|||:|||:..  
plant   363 HVFLLDPVLASGYSAVKAITLLLSKGVPESHIIFLNLIAAPQGIHALCKKFPMLKIVTSEIDSSL 427

  Fly   248 -----VAP--NHFGQKYF 258
                 |.|  ..|..:||
plant   428 NEDSRVIPGLGEFADRYF 445

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 81/174 (47%)
UKL5NP_189380.1 UMPK 31..228 CDD:238981
UPRTase 246..447 CDD:405383 87/201 (43%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.