DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and si:ch211-243j20.2

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_021324336.1 Gene:si:ch211-243j20.2 / 563597 ZFINID:ZDB-GENE-041014-345 Length:542 Species:Danio rerio


Alignment Length:257 Identity:97/257 - (37%)
Similarity:136/257 - (52%) Gaps:30/257 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HQQPQQEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGSNLKLLECNSQVAELLTILRDKNTTRS 86
            |...|.|.::....:.....||...|..          ..|.::|...||..:.||:|:|.|:|.
Zfish   289 HVHSQLEKRKLRWDISALASAHQGQPLP----------KTLSVMESTPQVRGMHTIIRNKETSRD 343

  Fly    87 DFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGLKYRSGN--CGVSIIRSGEAMEQGLRD 149
            :|.||:.||:||:||.:|:.||.....||||.|.:||| |..||.  .||||:|:||.|||.|..
Zfish   344 EFIFYSKRLMRLLIEHALSFLPLKPVTVETPQGTVYEG-KRLSGKRITGVSILRAGETMEQALMA 407

  Fly   150 CCRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMYPIMSTGNTVLQAVNVLREHGVPES 214
            .|:.||:||||::::.:|.|..:.|.|.|.||....|:||...:|||...|.||.||.:|.|.|.
Zfish   408 VCKDIRLGKILIQTNHDTGEPELHYLRLPKDISEDYVILMDSTVSTGAAALMAVRVLLDHDVQED 472

  Fly   215 CIILSNLFCTPIAARTVVNAFPKLKILTS--------ELHPVAP--NHFGQKYF------DC 260
            .|.|.:|....:...:|..||||::|:|:        |.| :.|  .:||.:||      ||
Zfish   473 KIFLLSLLMAEMGVHSVAYAFPKVRIITTAVDKKVNDEFH-IIPGIGNFGDRYFGTDAPSDC 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 80/184 (43%)
si:ch211-243j20.2XP_021324336.1 UMPK 94..293 CDD:238981 1/3 (33%)
UPRTase 324..527 CDD:317125 87/204 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.