DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and uckl1b

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_005162063.1 Gene:uckl1b / 558466 ZFINID:ZDB-GENE-090311-45 Length:537 Species:Danio rerio


Alignment Length:247 Identity:90/247 - (36%)
Similarity:133/247 - (53%) Gaps:20/247 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HQQPQQEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGSNLKLLECNSQVAELLTILRDKNTTRS 86
            |...|.|.::....:.....||.|.|..          ..|.:||...||..:.||:|:|:|.|.
Zfish   283 HVHSQLEERKLRWDMAALASAHQAQPLP----------QTLSVLESTPQVRGMHTIIRNKDTNRD 337

  Fly    87 DFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGLKYRSGN-CGVSIIRSGEAMEQGLRDC 150
            :|.||:.||:||:||.:|:.||.....|:||.|..|||..:.... .||||:|:||.||..||..
Zfish   338 EFIFYSKRLMRLLIERALSFLPSQVHIVQTPQGEDYEGRIFHGKRITGVSILRAGETMEPALRAV 402

  Fly   151 CRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMYPIMSTGNTVLQAVNVLREHGVPESC 215
            |:.:||||||::::.:|.|..:.|.|.|.||....|:||...:|||...:.|:.||.:|.|.|..
Zfish   403 CKDVRIGKILIQTNQDTGEPELHYLRLPKDISEDHVILMDCTVSTGAAAMMAIRVLLDHDVQEEK 467

  Fly   216 IILSNLFCTPIAARTVVNAFPKLKILT-------SELHPVAP--NHFGQKYF 258
            |:|.:|....:...:|..|||::||:|       ::|..:.|  .:||.:||
Zfish   468 ILLVSLLMAEMGVHSVAYAFPQVKIITTAVDKKVNDLFHIIPGIGNFGDRYF 519

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 74/182 (41%)
uckl1bXP_005162063.1 Udk 81..294 CDD:223645 3/10 (30%)
UMPK 88..287 CDD:238981 1/3 (33%)
UPRTase 318..521 CDD:291353 80/202 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.