DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and UCKL1

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:XP_024307683.1 Gene:UCKL1 / 54963 HGNCID:15938 Length:612 Species:Homo sapiens


Alignment Length:339 Identity:80/339 - (23%)
Similarity:118/339 - (34%) Gaps:144/339 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 GSP----SSSGSQSEEGSSSSDHQQPQQEAQEQEQQLH-----TPTHAH---AAVPAATSEEILA 56
            |:|    :....:.||.::.:.|....|...:|.:::|     |...||   |.:||        
Human   316 GTPVPPAAPDAERPEEHAAGTGHAHHHQGQGDQSRRVHLLLQETDAAAHRARALLPA-------- 372

  Fly    57 EYGSNLKLLECNSQVAELLTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAI 121
                              |:.||     |:|                             |.||.
Human   373 ------------------LSGLR-----RTD-----------------------------PAGAG 385

  Fly   122 YEG--LKYRSGNC-------------------------GVSIIRSGEAMEQGLRDCCRSIRIGKI 159
            ..|  |...:|.|                         ||||:|:||.||..||..|:.:|||.|
Human   386 LCGQVLCGEAGTCLGTPGRGTGCWGGMWALSLPSPQITGVSILRAGETMEPALRAVCKDVRIGTI 450

  Fly   160 LVESDANTHEARVV------------------------------------YARFPDDIGSRQVLL 188
            |::::..|.|..|.                                    |.|.|.||....|:|
Human   451 LIQTNQLTGEPEVPGGSRGDEPGGRGQRELTARGRREPHLQPDPCCPQLHYLRLPKDISDDHVIL 515

  Fly   189 MYPIMSTGNTVLQAVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILT-------SELH 246
            |...:|||...:.||.||.:|.|||..|.|.:|....:...:|..|||:::|:|       ::|.
Human   516 MDCTVSTGAAAMMAVRVLLDHDVPEDKIFLLSLLMAEMGVHSVAYAFPRVRIITTAVDKRVNDLF 580

  Fly   247 PVAP--NHFGQKYF 258
            .:.|  .:||.:||
Human   581 RIIPGIGNFGDRYF 594

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 60/244 (25%)
UCKL1XP_024307683.1 UMPK 101..307 CDD:238981
UPRTase <417..596 CDD:317125 54/178 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - O PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.