DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and uck1

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001004666.1 Gene:uck1 / 447928 ZFINID:ZDB-GENE-040912-113 Length:277 Species:Danio rerio


Alignment Length:181 Identity:32/181 - (17%)
Similarity:50/181 - (27%) Gaps:92/181 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 GSSSSDHQQ----------------PQQEAQEQEQQ--------------------------LHT 38
            |.:..||.|                |:|:|:..:.|                          :..
Zfish    42 GQNKVDHHQRKVTIVSQDSFYRVLTPEQKAKALKGQYNFDHPDAFDTEFMCQTLKDIVEGKVVEV 106

  Fly    39 PTH---AHAAVP---------AATSEEILAEYGSNLK-------LLECNSQVAELLTILRDKNTT 84
            ||:   .|:.:|         ....|.||..|...::       .::.:|.|.....:|||.|..
Zfish   107 PTYDFVTHSRLPEKICVYPADVVLFEGILVFYTQEVRDMFHMKQFVDTDSDVRLSRRVLRDMNRG 171

  Fly    85 RSDFKFYADRLIRLVIEESLNQLPYT----------------HCDVETPTG 119
            |.             :|:.|.|  ||                :.||..|.|
Zfish   172 RD-------------LEQILTQ--YTTFVKPAFEEFCLPTKKYADVIIPRG 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 15/66 (23%)
uck1NP_001004666.1 Udk 15..226 CDD:223645 32/181 (18%)
UMPK 19..224 CDD:238981 32/181 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 241..277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.