DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and CG12016

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_647805.1 Gene:CG12016 / 38411 FlyBaseID:FBgn0035436 Length:323 Species:Drosophila melanogaster


Alignment Length:96 Identity:23/96 - (23%)
Similarity:30/96 - (31%) Gaps:34/96 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 HQQ-PQQEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGSNLKLLECNSQVAELLTILRDKNT-- 83
            ||| ..|..|.|:||.|                          ::..|:|:|   ..||||..  
  Fly   152 HQQHHHQHHQIQQQQQH--------------------------IMSINAQIA---AQLRDKKVNF 187

  Fly    84 --TRSDFKFYADRLIRLVIEESLNQLPYTHC 112
              ......|....|:.|...:....|||..|
  Fly   188 LLVEGFMIFNQPELLALCNIKYHFHLPYEKC 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 13/47 (28%)
CG12016NP_647805.1 NRK1 6..255 CDD:238982 23/96 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10285
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.