powered by:
Protein Alignment kri and CG12016
DIOPT Version :9
Sequence 1: | NP_001261451.1 |
Gene: | kri / 38655 |
FlyBaseID: | FBgn0035639 |
Length: | 261 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_647805.1 |
Gene: | CG12016 / 38411 |
FlyBaseID: | FBgn0035436 |
Length: | 323 |
Species: | Drosophila melanogaster |
Alignment Length: | 96 |
Identity: | 23/96 - (23%) |
Similarity: | 30/96 - (31%) |
Gaps: | 34/96 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 22 HQQ-PQQEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGSNLKLLECNSQVAELLTILRDKNT-- 83
||| ..|..|.|:||.| ::..|:|:| ..||||..
Fly 152 HQQHHHQHHQIQQQQQH--------------------------IMSINAQIA---AQLRDKKVNF 187
Fly 84 --TRSDFKFYADRLIRLVIEESLNQLPYTHC 112
......|....|:.|...:....|||..|
Fly 188 LLVEGFMIFNQPELLALCNIKYHFHLPYEKC 218
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
kri | NP_001261451.1 |
UPRTase |
70..245 |
CDD:291353 |
13/47 (28%) |
CG12016 | NP_647805.1 |
NRK1 |
6..255 |
CDD:238982 |
23/96 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10285 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.100 |
|
Return to query results.
Submit another query.