DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and l(2)k01209

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_725672.2 Gene:l(2)k01209 / 36953 FlyBaseID:FBgn0022029 Length:626 Species:Drosophila melanogaster


Alignment Length:261 Identity:102/261 - (39%)
Similarity:140/261 - (53%) Gaps:41/261 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 PTHAHA--AVPAATSEEI-------------------LAEYGSN----------LKLLECNSQVA 72
            ||.|||  .||.....::                   |.|..:|          |.||....|:.
  Fly   358 PTMAHADIIVPRGGDNKVAIHLIVQHVHTQLQLRGFKLRETLANSYKDQPMPHSLHLLHPTPQIK 422

  Fly    73 ELLTILRDKNTTRSDFKFYADRLIRLVIEESLNQLPYTHCDVETPTGAIYEGLKYRSGN-CGVSI 136
            .|.|.:|.:||:|.:|.||:.||||||||.:|:..|:....||||.|.:|||.:..|.. |||||
  Fly   423 GLHTFIRCRNTSRDEFIFYSKRLIRLVIEYALSLFPFKKTTVETPQGVLYEGKRMESRKICGVSI 487

  Fly   137 IRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSRQVLLMYPIMSTGNTVLQ 201
            :|:||.|||.:.|.|:.|||||||::::..|.|..:.|.|.|.||...:|:||...::||...:.
  Fly   488 LRAGETMEQAVCDVCKDIRIGKILIQTNLKTGEPELYYLRLPKDIKDYKVILMDATVATGAAAMM 552

  Fly   202 AVNVLREHGVPESCIILSNLFCTPIAARTVVNAFPKLKILTSELHP-------VAP--NHFGQKY 257
            |:.||.:|.|||..|||::|....|...::..||||:||:||.|.|       |.|  .:||.:|
  Fly   553 AIRVLLDHDVPEDNIILASLLMAEIGVHSIAYAFPKVKIVTSALDPEINSKFYVIPGIGNFGDRY 617

  Fly   258 F 258
            |
  Fly   618 F 618

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 81/175 (46%)
l(2)k01209NP_725672.2 Udk 186..397 CDD:223645 8/38 (21%)
UMPK 188..387 CDD:238981 7/28 (25%)
UPRTase 417..620 CDD:291353 89/202 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446867
Domainoid 1 1.000 79 1.000 Domainoid score I465
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 1 1.100 - - P PTHR10285
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1606
SonicParanoid 00.000 Not matched by this tool.
76.880

Return to query results.
Submit another query.