DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and uck2b

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_956058.1 Gene:uck2b / 327057 ZFINID:ZDB-GENE-030131-5265 Length:261 Species:Danio rerio


Alignment Length:224 Identity:47/224 - (20%)
Similarity:76/224 - (33%) Gaps:87/224 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 AAVPAATSEEILAEYGSNLKLLECNSQVAEL--------LTILRDKNTTRSDFKF-YAD------ 93
            |:..::..|:|:...|.| |:.....||..|        ||..:.....:..|.| :.|      
Zfish    32 ASGKSSVCEKIMELLGQN-KIDRHQRQVVILSQDSFYRELTPEQKAKAVKGQFNFDHPDAFDSEL 95

  Fly    94 --RLIRLVIEESLNQLP----YTH-----------CDVETPTGAIYEG-LKYRSGNCGVSIIRSG 140
              :.:|.:|:.....:|    .||           .||     .::|| |.:.|           
Zfish    96 IMKTLRDIIQGKTVHIPVYDFVTHSRKDEFLTLYPADV-----VLFEGILMFYS----------- 144

  Fly   141 EAMEQGLRDCCRSIRIGKILVESDANTHEARVVYARFPDDIGSR-----QVLLMY---------- 190
                |.:||..:.    |:.|::|.:|..:|    |...||..|     |||..|          
Zfish   145 ----QEIRDLFKM----KLFVDTDPDTRLSR----RVLRDISERGRELEQVLNQYITFVKPAFEE 197

  Fly   191 ----------PIMSTGNTVLQAVNVLREH 209
                      .|:..|...|.|:|::.:|
Zfish   198 FCLPTKKYADVIIPRGADNLVAINLIVQH 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 41/198 (21%)
uck2bNP_956058.1 Udk 17..232 CDD:223645 47/224 (21%)
UMPK 24..230 CDD:238981 47/224 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..261
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.