DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment kri and Uck1

DIOPT Version :9

Sequence 1:NP_001261451.1 Gene:kri / 38655 FlyBaseID:FBgn0035639 Length:261 Species:Drosophila melanogaster
Sequence 2:NP_001101301.2 Gene:Uck1 / 311864 RGDID:1308313 Length:283 Species:Rattus norvegicus


Alignment Length:252 Identity:43/252 - (17%)
Similarity:85/252 - (33%) Gaps:77/252 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 SSSGSQSEEGSSSSDHQQPQQEAQEQEQQLHTPTHAHAAVPAATSEEILAEYGSN--------LK 63
            |:.|..||..:..:|..||:       ..|...:...|:..:...|:|:...|.|        |.
  Rat     9 SAGGGGSESAAPEADRPQPR-------PFLIGVSGGTASGKSTVCEKIMELLGQNEVDRRQRKLV 66

  Fly    64 LL--ECNSQVAELLTILRDKNTTRSDFKF-YAD--------RLIRLVIEESLNQLP----YTHCD 113
            :|  :|..:|   ||..:.....:..:.| :.|        :.::.::|....::|    .||..
  Rat    67 ILSQDCFYKV---LTAEQKAKALKGQYNFDHPDAFDNDLMHKTLKNIVEGKTVEVPTYDFVTHSR 128

  Fly   114 VETPT------GAIYEGLKYRSGNCGVSIIRSGEAMEQGLRDCCRSIRIGKILVESDANTHEARV 172
            :...|      ..::||:..              ...|.:||....    ::.|::|::...:|.
  Rat   129 LPETTVVYPADVVLFEGILV--------------FYTQEIRDMFHL----RLFVDTDSDVRLSRR 175

  Fly   173 VYARFPDDIGSRQVLLMYP--------------------IMSTGNTVLQAVNVLREH 209
            |...........|:|..|.                    |:..|...:.|:|::.:|
  Rat   176 VLRDVQRGRDLEQILTQYTAFVKPAFEEFCLPTKKYADVIIPRGVDNMVAINLIVQH 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
kriNP_001261451.1 UPRTase 70..245 CDD:291353 27/179 (15%)
Uck1NP_001101301.2 UMPK 31..236 CDD:238981 36/223 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D929897at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100147
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.